Clone Name | rbasd16k21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YBDL_ECOLI (P77806) Aminotransferase ybdL (EC 2.6.1.-) | 29 | 4.1 | 2 | AAT_PYRHO (O58489) Aspartate aminotransferase (EC 2.6.1.1) (Tran... | 29 | 4.1 | 3 | TENS1_HUMAN (Q9HBL0) Tensin-1 | 28 | 9.1 |
---|
>YBDL_ECOLI (P77806) Aminotransferase ybdL (EC 2.6.1.-)| Length = 386 Score = 28.9 bits (63), Expect = 4.1 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 76 DDFEVVRWLATKHGVAVIP 20 DD E +WL +HGVA IP Sbjct: 333 DDVEFCQWLTQEHGVAAIP 351
>AAT_PYRHO (O58489) Aspartate aminotransferase (EC 2.6.1.1) (Transaminase A)| (AspAT) Length = 391 Score = 28.9 bits (63), Expect = 4.1 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -2 Query: 133 VKGGEGAIYLWAKLPDNCKDDFEVVRWLATKHGVAVIPGSASG 5 VK +GA Y++ + + WL K V VIPG+A G Sbjct: 316 VKEPKGAFYVFPNISGTGMSSEKFSEWLLEKARVVVIPGTAFG 358
>TENS1_HUMAN (Q9HBL0) Tensin-1| Length = 1735 Score = 27.7 bits (60), Expect = 9.1 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Frame = +3 Query: 3 PPLALPGITATPCLVASHLTTSKS------SLQLSGSLAQR 107 PP +LPG+TA P L T+ S L L G +A R Sbjct: 835 PPASLPGLTAQPLLSPKEATSDPSRTPEEEPLNLEGLVAHR 875 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,552,981 Number of Sequences: 219361 Number of extensions: 260637 Number of successful extensions: 805 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)