Clone Name | rbasd16i08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PCSK9_HUMAN (Q8NBP7) Proprotein convertase subtilisin/kexin type... | 30 | 4.4 | 2 | HTR4_HALSA (Q9HP84) Halobacterial transducer protein IV | 30 | 7.6 | 3 | ARFG_ARATH (P93022) Auxin response factor 7 (Non-phototropic hyp... | 29 | 9.9 |
---|
>PCSK9_HUMAN (Q8NBP7) Proprotein convertase subtilisin/kexin type 9 precursor| (EC 3.4.21.-) (Proprotein convertase PC9) (Subtilisin/kexin-like protease PC9) (Neural apoptosis-regulated convertase 1) (NARC-1) Length = 692 Score = 30.4 bits (67), Expect = 4.4 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -1 Query: 406 SLHSGSGTCGEVVAQTLMQEALASLRSTTMSRKRRGVRMES 284 S HSG +A+ E L S S + S KRRG RME+ Sbjct: 462 SAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEA 502
>HTR4_HALSA (Q9HP84) Halobacterial transducer protein IV| Length = 810 Score = 29.6 bits (65), Expect = 7.6 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 391 NLSGGTGGESQTLSAARELPAASESHAGKTIDHL 492 +LS T GE+Q++SAA E AAS S +++ L Sbjct: 749 DLSDSTAGEAQSVSAAAEEQAASMSEISDSVESL 782
>ARFG_ARATH (P93022) Auxin response factor 7 (Non-phototropic hypocotyl 4)| (Protein BIPOSTO) (Auxin-responsive protein IAA21/IAA23/IAA25) Length = 1164 Score = 29.3 bits (64), Expect = 9.9 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 7/42 (16%) Frame = -3 Query: 491 RWSMVFPAWDSDAAGSSRAAESVWDSPPV-------PPLRFR 387 +W + WD AAG + SVWD PV PP FR Sbjct: 330 QWRNLQIGWDESAAGDRPSRVSVWDIEPVLTPFYICPPPFFR 371 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,164,793 Number of Sequences: 219361 Number of extensions: 1384214 Number of successful extensions: 3728 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3728 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)