| Clone Name | rbasd16h16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SOB_DROME (Q9VQS7) Protein sister of odd and bowel | 27 | 9.0 | 2 | HXA4_CHICK (P17277) Homeobox protein Hox-A4 (Chox-1.4) | 27 | 9.0 |
|---|
>SOB_DROME (Q9VQS7) Protein sister of odd and bowel| Length = 578 Score = 27.3 bits (59), Expect = 9.0 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -1 Query: 204 NEKRCLWVTDKGANKKSKSVGSNYNSCKLL--PFGRKFTLSGLGVAVVVTCESATQVL 37 N K T A+KKS+S SN N C P G K T + A T +AT L Sbjct: 68 NHKPSAAATATAAHKKSESCNSNGNKCTAATSPIGSK-TSNAAMAAATATAAAATNDL 124
>HXA4_CHICK (P17277) Homeobox protein Hox-A4 (Chox-1.4)| Length = 309 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 279 PCVERKKESSSALT*ATLLPRRC*RTQSCHSHHPHPH 389 PC E + S SA + A S H HHPHPH Sbjct: 19 PCEEYTQHSGSAGSSA-----------SYHPHHPHPH 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,541,185 Number of Sequences: 219361 Number of extensions: 699330 Number of successful extensions: 1631 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1630 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)