Clone Name | rbasd16h15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | M4K3_HUMAN (Q8IVH8) Mitogen-activated protein kinase kinase kina... | 30 | 4.2 | 2 | META_VIBCH (Q9KRM5) Homoserine O-succinyltransferase (EC 2.3.1.4... | 29 | 9.3 |
---|
>M4K3_HUMAN (Q8IVH8) Mitogen-activated protein kinase kinase kinase kinase 3| (EC 2.7.11.1) (MAPK/ERK kinase kinase kinase 3) (MEK kinase kinase 3) (MEKKK 3) (Germinal center kinase-related protein kinase) (GLK) Length = 894 Score = 30.0 bits (66), Expect = 4.2 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 9/50 (18%) Frame = -3 Query: 140 HIHLCSSL-----LLRWMCKLQFLTLLPHIDSIIKFPC----XLVTPEQE 18 H +LC +L LL W+ +Q L+ HID I P LV PEQE Sbjct: 685 HKYLCGALQTSIVLLEWVEPMQKFMLIKHIDFPIPCPLRMFEMLVVPEQE 734
>META_VIBCH (Q9KRM5) Homoserine O-succinyltransferase (EC 2.3.1.46) (Homoserine| O-transsuccinylase) (HTS) Length = 313 Score = 28.9 bits (63), Expect = 9.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 347 HPPHIGVVLHGETIHTLREAVGTRVPIHCWPS 442 HP + LHGE + L E + +P++ +P+ Sbjct: 235 HPEYDAYTLHGEYVRDLGEGLNPAIPVNYYPN 266 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,230,682 Number of Sequences: 219361 Number of extensions: 1446571 Number of successful extensions: 3721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3721 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)