Clone Name | rbasd16g21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RK34_SPIOL (P82244) 50S ribosomal protein L34, chloroplast precu... | 64 | 1e-10 | 2 | XISA_ANASP (P08862) Excisase A (NifD element site-specific recom... | 29 | 5.2 | 3 | GYRB_NEIGO (P22118) DNA gyrase subunit B (EC 5.99.1.3) | 29 | 5.2 | 4 | PEX2_PODAN (P51021) Peroxisomal biogenesis factor 2 (Peroxin-2) ... | 28 | 6.7 |
---|
>RK34_SPIOL (P82244) 50S ribosomal protein L34, chloroplast precursor| Length = 152 Score = 64.3 bits (155), Expect = 1e-10 Identities = 35/71 (49%), Positives = 41/71 (57%) Frame = -1 Query: 351 LTTRRPRGLQIRAGKAALCLTKRSRSRKSLARVHGFXXXXXXXXXXXXXXXXXXXXXKIL 172 ++T R R +RAGKAALCLTKRSRSRKSLAR HGF KIL Sbjct: 79 VSTDRCRRFVVRAGKAALCLTKRSRSRKSLARTHGFRLRMSTTSGRALLKRRRAKGRKIL 138 Query: 171 CTKSNSPTGTK 139 CTK+N +G + Sbjct: 139 CTKTNPSSGKR 149
>XISA_ANASP (P08862) Excisase A (NifD element site-specific recombinase)| Length = 472 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 250 WFPKADADYCWKKGSEA*T*QRKEDPLHKVKLTHWD 143 W K + D WK E T +R+ PLHK + +D Sbjct: 300 WLSKENIDLTWKVDKECKTGERQALPLHKEWIDEFD 335
>GYRB_NEIGO (P22118) DNA gyrase subunit B (EC 5.99.1.3)| Length = 781 Score = 28.9 bits (63), Expect = 5.2 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 90 KLTAGIHNASHCAVINTLSQWVSLTLCR 173 K++ G+H +V+N LS WV+LT+ R Sbjct: 114 KISGGLHGVG-VSVVNALSDWVTLTIYR 140
>PEX2_PODAN (P51021) Peroxisomal biogenesis factor 2 (Peroxin-2) (Peroxisomal| protein CAR1) Length = 554 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 200 RFRTLLPAVVRIRLRKPCTRASDFLDLDLLVRQ 298 R+RTLL V+R+RL P ++ S + + L RQ Sbjct: 274 RYRTLLDRVLRMRLAPPTSQVSREVSFEYLNRQ 306 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,424,249 Number of Sequences: 219361 Number of extensions: 946522 Number of successful extensions: 1893 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1893 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)