ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd16g08 |
|---|---|
| Clone Library Name | barley_pub |
>UBC4_WHEAT (P16577) Ubiquitin-conjugating enzyme E2-23 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 184 Score = 192 bits (489), Expect = 5e-49 Identities = 96/121 (79%), Positives = 96/121 (79%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE Sbjct: 64 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 123 Query: 402 AASLMMRDKNAYEQKVKEYCERYXXXXXXXXXXXXXXXXXXXXXXEVCDSGDEAIMGHAD 223 AASLMMRDKNAYE KVKEYCERY E DSGDEAIMGHAD Sbjct: 124 AASLMMRDKNAYENKVKEYCERYAKPEDISPEEEEEESDEELSDAEGYDSGDEAIMGHAD 183 Query: 222 P 220 P Sbjct: 184 P 184
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 161 bits (408), Expect = 1e-39 Identities = 79/122 (64%), Positives = 86/122 (70%), Gaps = 1/122 (0%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PS+GF KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN+FE FLPQLLLYPNPSDPLNGE Sbjct: 64 PSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGE 123 Query: 402 AASLMMRDKNAYEQKVKEYCERYXXXXXXXXXXXXXXXXXXXXXXEVCDSGDE-AIMGHA 226 AA+LMMRD+ YEQ+VKEYCE+Y D D+ AI G Sbjct: 124 AAALMMRDRPTYEQRVKEYCEKYAKPRADTEEMSSDDEMSEDEYASDGDDEDDVAIAGKL 183 Query: 225 DP 220 DP Sbjct: 184 DP 185
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 161 bits (407), Expect = 1e-39 Identities = 72/83 (86%), Positives = 79/83 (95%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PS+GF KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN+FE FLPQLLLYPNPSDPLNGE Sbjct: 64 PSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGE 123 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 AA+LMMRD+ AYEQ+VKEYCE+Y Sbjct: 124 AAALMMRDRPAYEQRVKEYCEKY 146
>UBC6_ARATH (P42750) Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 6) (Ubiquitin carrier protein 6) Length = 183 Score = 160 bits (404), Expect = 3e-39 Identities = 78/121 (64%), Positives = 86/121 (71%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PS+GF NKIYHPNVDE SG+VCLDVINQTWSPMFDL+N+FE FLPQLLLYPNPSDP NGE Sbjct: 64 PSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPFNGE 123 Query: 402 AASLMMRDKNAYEQKVKEYCERYXXXXXXXXXXXXXXXXXXXXXXEVCDSGDEAIMGHAD 223 AASL+MRD+ AYE KVKEYCE+Y D DE I+G AD Sbjct: 124 AASLLMRDRAAYELKVKEYCEKYAKPEEILSDDDDDDSMSEDGSDSDDDDDDE-IVGKAD 182 Query: 222 P 220 P Sbjct: 183 P 183
>UBE2H_MOUSE (P62257) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) Length = 183 Score = 128 bits (322), Expect = 1e-29 Identities = 55/83 (66%), Positives = 69/83 (83%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PSIGF NKI+HPN+DE SG+VCLDVINQTW+ ++DL NIFE FLPQLL YPNP DPLNG+ Sbjct: 66 PSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGD 125 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 AA++ + Y+QK+KEY ++Y Sbjct: 126 AAAMYLHRPEEYKQKIKEYIQKY 148
>UBE2H_HUMAN (P62256) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UbcH2) (E2-20K) Length = 183 Score = 128 bits (322), Expect = 1e-29 Identities = 55/83 (66%), Positives = 69/83 (83%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PSIGF NKI+HPN+DE SG+VCLDVINQTW+ ++DL NIFE FLPQLL YPNP DPLNG+ Sbjct: 66 PSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGD 125 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 AA++ + Y+QK+KEY ++Y Sbjct: 126 AAAMYLHRPEEYKQKIKEYIQKY 148
>UBC8_YEAST (P28263) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Glucose-induced degradation protein 3) Length = 218 Score = 124 bits (310), Expect = 3e-28 Identities = 54/83 (65%), Positives = 67/83 (80%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PSIGF NKI+HPN+D SGS+CLDVIN TWSP++DL+NI E +P LL PN SDPLN E Sbjct: 64 PSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNE 123 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 AA+L +RDK YE+K+KEY ++Y Sbjct: 124 AATLQLRDKKLYEEKIKEYIDKY 146
>UB2D1_MOUSE (P61080) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/83 (38%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P I FT KIYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL + Sbjct: 65 PKIAFTTKIYHPNINS-NGSICLDILRSQWSPALTVSKVL-LSICSLLCDPNPDDPLVPD 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + DK Y + +E+ ++Y Sbjct: 123 IAQIYKSDKEKYNRHAREWTQKY 145
>UB2D1_HUMAN (P51668) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (UbcH5) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/83 (38%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P I FT KIYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL + Sbjct: 65 PKIAFTTKIYHPNINS-NGSICLDILRSQWSPALTVSKVL-LSICSLLCDPNPDDPLVPD 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + DK Y + +E+ ++Y Sbjct: 123 IAQIYKSDKEKYNRHAREWTQKY 145
>UBC5_YEAST (P15732) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 70.9 bits (172), Expect = 3e-12 Identities = 34/83 (40%), Positives = 48/83 (57%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT KIYHPN++ SG++CLD++ WSP L + + + LL NP DPL E Sbjct: 66 PKVNFTTKIYHPNINS-SGNICLDILKDQWSPALTLSKVL-LSICSLLTDANPDDPLVPE 123 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + DK YE KE+ ++Y Sbjct: 124 IAQIYKTDKAKYEATAKEWTKKY 146
>UBC2_CAEEL (P35129) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) (Lethal protein 70) Length = 147 Score = 70.5 bits (171), Expect = 3e-12 Identities = 31/83 (37%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ Y Q +E+ ++Y Sbjct: 123 IARIYKTDRERYNQLAREWTQKY 145
>UB2D4_RAT (P70711) Ubiquitin-conjugating enzyme E2 D4 (EC 6.3.2.19)| (Ubiquitin-protein ligase D4) (Ubiquitin carrier protein D4) (Ubiquitin-conjugating enzyme E2-17 kDa 4) (E2(17)KB 4) Length = 147 Score = 70.5 bits (171), Expect = 3e-12 Identities = 31/83 (37%), Positives = 50/83 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPNV+ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVEFTTRIYHPNVNS-NGSICLDILRSQWSPALTISKVL-LSISSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D++ Y + +E+ ++Y Sbjct: 123 IAQIYKTDRDKYNRTAREWTQKY 145
>UBC2_WHEAT (P25866) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 70.5 bits (171), Expect = 3e-12 Identities = 31/82 (37%), Positives = 51/82 (62%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F ++++HPN+ GS+CLD++ WSP++D+ I + LL PNP+ P N E Sbjct: 68 PTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNPNSPANSE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA + +K Y +KV+E E+ Sbjct: 126 AARMYSENKREYNRKVREVVEQ 147
>UBC10_ARATH (P35133) Ubiquitin-conjugating enzyme E2-17 kDa 10/12 (EC 6.3.2.19)| (Ubiquitin-protein ligase 10/12) (Ubiquitin carrier protein 10/12) Length = 148 Score = 70.1 bits (170), Expect = 4e-12 Identities = 30/83 (36%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F K++HPN++ +GS+CLD++ + WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + DKN YE + + ++Y Sbjct: 123 IAHMYKTDKNKYESTARSWTQKY 145
>UBC4_SCHPO (P46595) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 69.7 bits (169), Expect = 6e-12 Identities = 31/83 (37%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVNFTTRIYHPNINS-NGSICLDILRDQWSPALTISKVL-LSICSLLTDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D++ YE +E+ +Y Sbjct: 123 IAHVYKTDRSRYELSAREWTRKY 145
>UBC9_ARATH (P35132) Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B) Length = 148 Score = 69.7 bits (169), Expect = 6e-12 Identities = 30/83 (36%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F K++HPN++ +GS+CLD++ + WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + DKN YE + + ++Y Sbjct: 123 IAHMYKTDKNKYESTARTWTQKY 145
>UBC2_MEDSA (P35130) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 69.7 bits (169), Expect = 6e-12 Identities = 30/82 (36%), Positives = 51/82 (62%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F ++++HPN+ GS+CLD++ WSP++D+ I + LL PNP+ P N E Sbjct: 68 PTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNPNSPANSE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA + +K Y ++V+E E+ Sbjct: 126 AARMFSENKREYNRRVREVVEQ 147
>UBC2_ARATH (P42745) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) Length = 152 Score = 69.3 bits (168), Expect = 8e-12 Identities = 30/82 (36%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F ++++HPN+ GS+CLD++ WSP++D+ I + LL PNP+ P N E Sbjct: 68 PTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNPNSPANSE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA + K Y ++V+E E+ Sbjct: 126 AARMFSESKREYNRRVREVVEQ 147
>UBC12_ASHGO (Q75AF2) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 69.3 bits (168), Expect = 8e-12 Identities = 35/77 (45%), Positives = 50/77 (64%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ N IYHPN+D SG++CL+V+ + WSP+ DL + + L L L PN SDPLN + Sbjct: 92 PTVKCLNTIYHPNID-YSGNICLNVLREDWSPVMDLQTVV-LGLLFLFLEPNGSDPLNRQ 149 Query: 402 AASLMMRDKNAYEQKVK 352 AA M+RD +E V+ Sbjct: 150 AADTMLRDPYRFETNVQ 166
>UBE2A_MOUSE (Q9Z255) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (mHR6A) Length = 152 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/82 (39%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPNV GS+CLD++ WSP +D+ +I + LL PNP+ P N + Sbjct: 68 PTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNPNSPANSQ 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L +K YE++V E+ Sbjct: 126 AAQLYQENKREYEKRVSAIVEQ 147
>UBE2A_HUMAN (P49459) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (hHR6A) Length = 152 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/82 (39%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPNV GS+CLD++ WSP +D+ +I + LL PNP+ P N + Sbjct: 68 PTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNPNSPANSQ 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L +K YE++V E+ Sbjct: 126 AAQLYQENKREYEKRVSAIVEQ 147
>UBCD1_DROME (P25867) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) Length = 147 Score = 68.6 bits (166), Expect = 1e-11 Identities = 30/83 (36%), Positives = 48/83 (57%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ Y + +E+ +Y Sbjct: 123 IARIYKTDREKYNELAREWTRKY 145
>UB2D2_XENLA (P62840) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Xubc4) Length = 147 Score = 68.6 bits (166), Expect = 1e-11 Identities = 30/83 (36%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ Y + +E+ ++Y Sbjct: 123 IARIYKTDREKYNRIAREWTQKY 145
>UB2D2_RAT (P62839) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 68.6 bits (166), Expect = 1e-11 Identities = 30/83 (36%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ Y + +E+ ++Y Sbjct: 123 IARIYKTDREKYNRIAREWTQKY 145
>UB2D2_MOUSE (P62838) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 68.6 bits (166), Expect = 1e-11 Identities = 30/83 (36%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ Y + +E+ ++Y Sbjct: 123 IARIYKTDREKYNRIAREWTQKY 145
>UB2D2_HUMAN (P62837) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 68.6 bits (166), Expect = 1e-11 Identities = 30/83 (36%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ Y + +E+ ++Y Sbjct: 123 IARIYKTDREKYNRIAREWTQKY 145
>UBC11_ARATH (P35134) Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19)| (Ubiquitin-protein ligase 11) (Ubiquitin carrier protein 11) Length = 148 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/83 (34%), Positives = 49/83 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F K+YHPN++ +GS+CLD++ + WSP + + + + LL PNP DPL E Sbjct: 65 PKVSFKTKVYHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D++ YE + + ++Y Sbjct: 123 IAHMYKTDRSKYESTARSWTQKY 145
>UBE2B_RAT (P63149) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 68.6 bits (166), Expect = 1e-11 Identities = 32/82 (39%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPNV GS+CLD++ WSP +D+ +I + LL PNP+ P N + Sbjct: 68 PTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNPNSPANSQ 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L +K YE++V E+ Sbjct: 126 AAQLYQENKREYEKRVSAIVEQ 147
>UBE2B_RABIT (P63148) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 68.6 bits (166), Expect = 1e-11 Identities = 32/82 (39%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPNV GS+CLD++ WSP +D+ +I + LL PNP+ P N + Sbjct: 68 PTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNPNSPANSQ 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L +K YE++V E+ Sbjct: 126 AAQLYQENKREYEKRVSAIVEQ 147
>UBE2B_MOUSE (P63147) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) Length = 152 Score = 68.6 bits (166), Expect = 1e-11 Identities = 32/82 (39%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPNV GS+CLD++ WSP +D+ +I + LL PNP+ P N + Sbjct: 68 PTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNPNSPANSQ 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L +K YE++V E+ Sbjct: 126 AAQLYQENKREYEKRVSAIVEQ 147
>UBE2B_HUMAN (P63146) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) Length = 152 Score = 68.6 bits (166), Expect = 1e-11 Identities = 32/82 (39%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPNV GS+CLD++ WSP +D+ +I + LL PNP+ P N + Sbjct: 68 PTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNPNSPANSQ 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L +K YE++V E+ Sbjct: 126 AAQLYQENKREYEKRVSAIVEQ 147
>UB2D3_RAT (P61078) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) (Phosphoarginine phosphatase) (PAPase) Length = 147 Score = 68.2 bits (165), Expect = 2e-11 Identities = 30/83 (36%), Positives = 50/83 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D++ Y + +E+ ++Y Sbjct: 123 IARIYKTDRDKYNRISREWTQKY 145
>UB2D3_MOUSE (P61079) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 68.2 bits (165), Expect = 2e-11 Identities = 30/83 (36%), Positives = 50/83 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D++ Y + +E+ ++Y Sbjct: 123 IARIYKTDRDKYNRISREWTQKY 145
>UB2D3_HUMAN (P61077) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 68.2 bits (165), Expect = 2e-11 Identities = 30/83 (36%), Positives = 50/83 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D++ Y + +E+ ++Y Sbjct: 123 IARIYKTDRDKYNRISREWTQKY 145
>UBC1_ARATH (P25865) Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 152 Score = 67.8 bits (164), Expect = 2e-11 Identities = 29/82 (35%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F ++++HPN+ GS+CLD++ WSP++D+ I + LL PNP+ P N E Sbjct: 68 PTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNPNSPANSE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA + K Y ++V++ E+ Sbjct: 126 AARMYSESKREYNRRVRDVVEQ 147
>UBC3_ARATH (P42746) Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 3) (Ubiquitin carrier protein 3) Length = 150 Score = 67.8 bits (164), Expect = 2e-11 Identities = 31/82 (37%), Positives = 48/82 (58%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPN+ GS+CLD++ WSP++D+ + + LL PNP P N E Sbjct: 68 PIVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAVL-TSIQSLLCDPNPDSPANAE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L +K Y +KV E E+ Sbjct: 126 AARLFSENKREYNRKVIEIVEQ 147
>UBC12_SCHPO (O74549) NEDD8-conjugating enzyme ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 177 Score = 67.0 bits (162), Expect = 4e-11 Identities = 33/77 (42%), Positives = 50/77 (64%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + NKIYHPN+D + G+VCL+++ Q W+P+ +L +I V L L L PN DPLN E Sbjct: 85 PKVKCLNKIYHPNID-IEGNVCLNILRQDWNPVLNLNSIL-VGLQFLFLSPNAEDPLNKE 142 Query: 402 AASLMMRDKNAYEQKVK 352 AA+ + +D + +V+ Sbjct: 143 AAADLHKDPQGFASRVR 159
>UBC4_CANAL (P43102) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 67.0 bits (162), Expect = 4e-11 Identities = 31/83 (37%), Positives = 48/83 (57%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P I T KIYHPN++ +G++CLD++ WSP + + + + LL NP DPL E Sbjct: 65 PKIALTTKIYHPNINS-NGNICLDILKDQWSPALTISKVL-LSICSLLTDANPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + +D+ YE KE+ ++Y Sbjct: 123 IAHIYKQDRKKYEATAKEWTKKY 145
>UBC4_YEAST (P15731) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 148 Score = 67.0 bits (162), Expect = 4e-11 Identities = 32/83 (38%), Positives = 48/83 (57%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P I FT KIYHPN++ +G++CLD++ WSP L + + + LL NP DPL E Sbjct: 66 PKISFTTKIYHPNINA-NGNICLDILKDQWSPALTLSKVL-LSICSLLTDANPDDPLVPE 123 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ YE +E+ ++Y Sbjct: 124 IAHIYKTDRPKYEATAREWTKKY 146
>UBC1_CAEEL (P52478) Ubiquitin-conjugating enzyme E2 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 192 Score = 66.6 bits (161), Expect = 5e-11 Identities = 31/82 (37%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPNV GS+CLD++ WSP +D+ I + LL PNP+ P N Sbjct: 68 PTVKFISKMFHPNV-YADGSICLDILQNRWSPTYDVAAIL-TSIQSLLDEPNPNSPANSL 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L ++ YE++V++ E+ Sbjct: 126 AAQLYQENRREYEKRVQQIVEQ 147
>UBC12_DROME (Q9VSF3) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-) (NEDD8 protein| ligase) (NEDD8 carrier protein) Length = 181 Score = 66.2 bits (160), Expect = 6e-11 Identities = 29/78 (37%), Positives = 49/78 (62%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + ++YHPN+D + G+VCL+++ + W+P+ + +N L L L PNP DPLN E Sbjct: 88 PKVKCATQVYHPNID-LDGNVCLNILREDWNPVLN-INSIVYGLQFLFLEPNPEDPLNKE 145 Query: 402 AASLMMRDKNAYEQKVKE 349 AA ++ ++ +E VK+ Sbjct: 146 AADVLQTNRRQFENNVKK 163
>UBCD6_DROME (P25153) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 66.2 bits (160), Expect = 6e-11 Identities = 31/82 (37%), Positives = 48/82 (58%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPNV G +CLD++ WSP +D+ I + LL PNP+ P N Sbjct: 68 PTVRFVSKVFHPNV-YADGGICLDILQNRWSPTYDVSAIL-TSIQSLLSDPNPNSPANST 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L ++ YE++VK E+ Sbjct: 126 AAQLYKENRREYEKRVKACVEQ 147
>UBC1_COLGL (O74196) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Colletotrichum hard-surface-induced protein 1) Length = 147 Score = 66.2 bits (160), Expect = 6e-11 Identities = 29/83 (34%), Positives = 48/83 (57%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + +L PNP +PL E Sbjct: 65 PKVNFTTRIYHPNINS-NGSICLDILRDQWSPALTISKVL-LSICSMLTDPNPDEPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ YE +E+ +Y Sbjct: 123 IAHVYKTDRARYEATAREWTRKY 145
>UBC8_ARATH (P35131) Ubiquitin-conjugating enzyme E2-17 kDa 8 (EC 6.3.2.19)| (Ubiquitin-protein ligase 8) (Ubiquitin carrier protein 8) (UBCAT4A) Length = 148 Score = 65.5 bits (158), Expect = 1e-10 Identities = 28/83 (33%), Positives = 48/83 (57%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F K++HPN++ +GS+CLD++ + WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ YE + + ++Y Sbjct: 123 IAHMYKTDRAKYEATARNWTQKY 145
>UBC4_LYCES (P35135) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 65.5 bits (158), Expect = 1e-10 Identities = 28/83 (33%), Positives = 48/83 (57%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F K++HPN++ +GS+CLD++ + WSP + + + + LL PNP DPL E Sbjct: 65 PKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + D+ YE + + ++Y Sbjct: 123 IAHMYKTDRAKYETTARSWTQKY 145
>UBC1_YEAST (P21734) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 65.5 bits (158), Expect = 1e-10 Identities = 27/83 (32%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F K+YHPN+ ++G++CLD++ WSP+ L + + L LL P P+DP + E Sbjct: 67 PKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSAL-ISLQALLQSPEPNDPQDAE 125 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A +RD+ ++ + + Y Sbjct: 126 VAQHYLRDRESFNKTAALWTRLY 148
>UBC12_YEAST (P52491) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 188 Score = 65.1 bits (157), Expect = 1e-10 Identities = 31/77 (40%), Positives = 48/77 (62%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + KI+HPN+D + G+VCL+++ + WSP DL +I L L L PNP+DPLN + Sbjct: 95 PKVVCLKKIFHPNID-LKGNVCLNILREDWSPALDLQSIITGLL-FLFLEPNPNDPLNKD 152 Query: 402 AASLMMRDKNAYEQKVK 352 AA L+ + + + V+ Sbjct: 153 AAKLLCEGEKEFAEAVR 169
>UBC12_XENTR (Q6P8D9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 64.7 bits (156), Expect = 2e-10 Identities = 29/77 (37%), Positives = 47/77 (61%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + +YHPN+D + G+VCL+++ + W P+ + +I L L L PNP DPLN E Sbjct: 91 PKVKCETMVYHPNID-LEGNVCLNILREDWKPVLTINSII-YGLQYLFLEPNPEDPLNKE 148 Query: 402 AASLMMRDKNAYEQKVK 352 AA ++ ++ +EQ V+ Sbjct: 149 AAEVLQNNRRLFEQNVQ 165
>UBC12_XENLA (Q6DCZ9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 64.7 bits (156), Expect = 2e-10 Identities = 29/77 (37%), Positives = 47/77 (61%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + +YHPN+D + G+VCL+++ + W P+ + +I L L L PNP DPLN E Sbjct: 91 PKVKCETMVYHPNID-LEGNVCLNILREDWKPVLTINSII-YGLQYLFLEPNPEDPLNKE 148 Query: 402 AASLMMRDKNAYEQKVK 352 AA ++ ++ +EQ V+ Sbjct: 149 AAEVLQNNRRLFEQNVQ 165
>UBC12_MOUSE (P61082) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 64.7 bits (156), Expect = 2e-10 Identities = 29/77 (37%), Positives = 47/77 (61%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + +YHPN+D + G+VCL+++ + W P+ + +I L L L PNP DPLN E Sbjct: 91 PKVKCETMVYHPNID-LEGNVCLNILREDWKPVLTINSII-YGLQYLFLEPNPEDPLNKE 148 Query: 402 AASLMMRDKNAYEQKVK 352 AA ++ ++ +EQ V+ Sbjct: 149 AAEVLQNNRRLFEQNVQ 165
>UBC12_HUMAN (P61081) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 64.7 bits (156), Expect = 2e-10 Identities = 29/77 (37%), Positives = 47/77 (61%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + +YHPN+D + G+VCL+++ + W P+ + +I L L L PNP DPLN E Sbjct: 91 PKVKCETMVYHPNID-LEGNVCLNILREDWKPVLTINSII-YGLQYLFLEPNPEDPLNKE 148 Query: 402 AASLMMRDKNAYEQKVK 352 AA ++ ++ +EQ V+ Sbjct: 149 AAEVLQNNRRLFEQNVQ 165
>UBC2_USTMA (Q4PFA5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 185 Score = 64.7 bits (156), Expect = 2e-10 Identities = 32/81 (39%), Positives = 48/81 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPNV +G +CLD++ WSP +D+ I + LL PNP+ P N E Sbjct: 68 PTVKFLSKMFHPNV-YANGELCLDILQNRWSPTYDVAAIL-TSIQSLLHDPNPNSPANAE 125 Query: 402 AASLMMRDKNAYEQKVKEYCE 340 AASL + Y ++VK E Sbjct: 126 AASLYRENMKEYVRRVKATVE 146
>UBC2_KLULA (Q6CUD9) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 164 Score = 64.3 bits (155), Expect = 2e-10 Identities = 30/82 (36%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPNV +G +CLD++ W+P +D+ +I + L PNP+ P N E Sbjct: 68 PHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFNDPNPASPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA+L K+ Y ++VKE E+ Sbjct: 126 AATLFQDHKSQYVKRVKETVEK 147
>UBC13_YEAST (P52490) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 153 Score = 64.3 bits (155), Expect = 2e-10 Identities = 29/83 (34%), Positives = 48/83 (57%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KIYHPN+D + G +CLDV+ WSP + + + + LL PNP+DPL + Sbjct: 67 PKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLAND 124 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A ++++ + K +E+ + Y Sbjct: 125 VAEDWIKNEQGAKAKAREWTKLY 147
>UBC1_MAGGR (Q9UVR2) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 147 Score = 64.3 bits (155), Expect = 2e-10 Identities = 29/83 (34%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +IYHPN++ +GS+CLD++ WSP + + + + +L PNP DPL E Sbjct: 65 PKVNFTTRIYHPNINS-NGSICLDILRDQWSPALTISKVL-LSICSMLTDPNPDDPLVPE 122 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + + YE +E+ +Y Sbjct: 123 IAHVYRTARAQYEATAREWTPKY 145
>UBC12_YARLI (Q6C9W0) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 179 Score = 64.3 bits (155), Expect = 2e-10 Identities = 30/77 (38%), Positives = 47/77 (61%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + K+YHPN+D + G+VCL+++ + W P+ L N + L L L PN SDPLN + Sbjct: 86 PKVKCLQKVYHPNID-LEGNVCLNILREDWKPVLSL-NAVMIGLQYLFLEPNASDPLNKD 143 Query: 402 AASLMMRDKNAYEQKVK 352 AA M ++ +++ VK Sbjct: 144 AAHQMTANREEFKRNVK 160
>UBC2_YEAST (P06104) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 172 Score = 63.9 bits (154), Expect = 3e-10 Identities = 30/82 (36%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPNV +G +CLD++ W+P +D+ +I + L PNP+ P N E Sbjct: 68 PHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFNDPNPASPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA+L K+ Y ++VKE E+ Sbjct: 126 AATLFKDHKSQYVKRVKETVEK 147
>UBC2_ASHGO (Q75EB8) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 170 Score = 63.9 bits (154), Expect = 3e-10 Identities = 30/82 (36%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPNV +G +CLD++ W+P +D+ +I + L PNP+ P N E Sbjct: 68 PHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFNDPNPASPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA+L K+ Y ++VKE E+ Sbjct: 126 AATLFKDHKSQYVKRVKETVEK 147
>UBC2_CANGA (Q6FR76) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 167 Score = 63.5 bits (153), Expect = 4e-10 Identities = 30/82 (36%), Positives = 50/82 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPNV +G +CLD++ W+P +D+ +I + L PNP+ P N E Sbjct: 68 PHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFNDPNPASPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA+L K+ Y ++VKE E+ Sbjct: 126 AATLFKDHKSQYIKRVKETVEK 147
>UBC2_CRYNE (Q5KN22) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 169 Score = 63.5 bits (153), Expect = 4e-10 Identities = 30/81 (37%), Positives = 49/81 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +K++HPN+ +G +CLD++ WSP +D+ I + LL PNP+ P N + Sbjct: 68 PTVRFISKMFHPNI-YANGELCLDILQNRWSPTYDVAAIL-TSVQSLLNDPNPASPANVD 125 Query: 402 AASLMMRDKNAYEQKVKEYCE 340 AA L + YE++VK+ E Sbjct: 126 AAQLFKENLKEYERRVKKTVE 146
>UBC11_SCHPO (O00103) Ubiquitin-conjugating enzyme E2-20 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 176 Score = 62.8 bits (151), Expect = 7e-10 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 4/85 (4%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P+I FT+ ++HPNVD MSG++CLD++ WS ++++ I + L LL PN + PLN + Sbjct: 93 PTIIFTSPMWHPNVD-MSGNICLDILKDKWSAVYNVQTIL-LSLQSLLGEPNNASPLNAQ 150 Query: 402 AASLMMRDKNAYE----QKVKEYCE 340 AA L +D Y+ Q+ KE E Sbjct: 151 AAELWSKDPIEYKRLLMQRYKEIDE 175
>UBCD3_DROME (P35128) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein bendless) Length = 151 Score = 62.4 bits (150), Expect = 9e-10 Identities = 30/83 (36%), Positives = 46/83 (55%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KIYHPN+D + G +CLDV+ WSP + I + + LL PNP DPL + Sbjct: 67 PKVRFITKIYHPNIDRL-GRICLDVLKDKWSPALQIRTIL-LSIQALLSAPNPDDPLAND 124 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A L ++ + +E+ ++Y Sbjct: 125 VAELWKVNEAEAIRNAREWTQKY 147
>UBC2_DEBHA (Q6BU36) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 168 Score = 61.6 bits (148), Expect = 2e-09 Identities = 32/81 (39%), Positives = 50/81 (61%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PS+ F ++++HPNV SG +CLD++ WSP +D+ +I + LL PN S P N E Sbjct: 68 PSVKFISEMFHPNV-YASGELCLDILQNRWSPTYDVSSIL-TSIQSLLNDPNISSPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCE 340 AA+L ++ Y ++V+E E Sbjct: 126 AANLYKDHRSQYIKRVRETVE 146
>UBC_MIMIV (Q5UQC9) Probable ubiquitin-conjugating enzyme E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 158 Score = 61.2 bits (147), Expect = 2e-09 Identities = 29/84 (34%), Positives = 51/84 (60%), Gaps = 1/84 (1%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQT-WSPMFDLVNIFEVFLPQLLLYPNPSDPLNG 406 P + F I H NV++ G +CL+++ + W+ ++++I + LL PNP DP N Sbjct: 71 PKVKFITPIQHMNVND-KGDICLNILKKDGWNASLNIISIIWSIIV-LLDQPNPEDPFNS 128 Query: 405 EAASLMMRDKNAYEQKVKEYCERY 334 E ASL DK +Y++K+++YC+ + Sbjct: 129 ELASLYRNDKLSYDKKIRDYCKTH 152
>UBC2_YARLI (Q6C093) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 60.5 bits (145), Expect = 3e-09 Identities = 30/81 (37%), Positives = 48/81 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F ++++HPNV SG +CLD++ WSP +D+ I + LL PN S P N E Sbjct: 68 PAVKFVSQMFHPNVYS-SGELCLDILQNRWSPTYDVAAIL-TSVQSLLNDPNTSSPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCE 340 A+ L + YE++V++ E Sbjct: 126 ASMLYKDHRQQYEKRVRDTVE 146
>UBC2_CANAL (O74201) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 179 Score = 60.1 bits (144), Expect = 5e-09 Identities = 31/81 (38%), Positives = 49/81 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPNV SG +CLD++ WSP +D+ +I + LL PN S P N E Sbjct: 68 PQVKFISEMFHPNV-YASGELCLDILQNRWSPTYDVSSIL-TSVQSLLNDPNISSPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCE 340 AA+L ++ Y ++V+E E Sbjct: 126 AANLYKDHRSLYVKRVRETVE 146
>UBC12_CANGA (Q6FVQ8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 187 Score = 60.1 bits (144), Expect = 5e-09 Identities = 31/77 (40%), Positives = 46/77 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + NKI+HPN+D G +CL+++ + WSP DL I + L L PN +DPLN E Sbjct: 96 PKVICNNKIFHPNIDP-HGKICLNILREDWSPALDLQCIV-LGLLSLFQEPNGNDPLNKE 153 Query: 402 AASLMMRDKNAYEQKVK 352 AA ++ +DK + V+ Sbjct: 154 AAEVLNKDKLEFGNLVR 170
>UBC11_YEAST (P52492) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 156 Score = 59.3 bits (142), Expect = 8e-09 Identities = 31/76 (40%), Positives = 46/76 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P I F + ++HPNVD+ SG++CLD++ + WS ++++ I + L LL PN PLN Sbjct: 73 PMIKFLSPMWHPNVDK-SGNICLDILKEKWSAVYNVETIL-LSLQSLLGEPNNRSPLNAV 130 Query: 402 AASLMMRDKNAYEQKV 355 AA L D Y +KV Sbjct: 131 AAELWDADMEEYRKKV 146
>UBC13_SCHPO (O13685) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 148 Score = 58.5 bits (140), Expect = 1e-08 Identities = 26/83 (31%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F KIYHPNVD++ G +CL + + WSP + + + + L+ PNP DPL+ + Sbjct: 66 PNVRFLTKIYHPNVDKL-GRICLSTLKKDWSPALQIRTVL-LSIQALMGAPNPDDPLDND 123 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A + ++ +E+ ++Y Sbjct: 124 VAKIWKENEPQAIANAREWTKKY 146
>UBC2_TRIHA (Q58FS2) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 58.5 bits (140), Expect = 1e-08 Identities = 28/82 (34%), Positives = 48/82 (58%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPNV +G +CLD++ WSP +D+ + + LL PN P N E Sbjct: 68 PQVKFISQMFHPNV-YANGELCLDILQNRWSPTYDVAAVL-TSIQSLLNDPNTGSPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 A++L ++ Y ++V+E ER Sbjct: 126 ASNLYKDNRREYIKRVRETVER 147
>UBC2_EMENI (Q96UP5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (UV sensitivity protein J) Length = 151 Score = 58.5 bits (140), Expect = 1e-08 Identities = 29/82 (35%), Positives = 49/82 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPNV +G +CLD++ WSP +D+ I + LL PN S P N E Sbjct: 68 PGVKFISQMFHPNVYG-TGELCLDILQNRWSPTYDVAAIL-TSIQSLLNDPNTSSPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 A++L ++ Y ++V+E E+ Sbjct: 126 ASNLYRDNRKEYIKRVRETVEK 147
>UBC2_ASPFU (Q4WLA7) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) Length = 151 Score = 58.5 bits (140), Expect = 1e-08 Identities = 29/82 (35%), Positives = 49/82 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPNV +G +CLD++ WSP +D+ I + LL PN S P N E Sbjct: 68 PGVKFISQMFHPNVYG-TGELCLDILQNRWSPTYDVAAIL-TSIQSLLNDPNTSSPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 A++L ++ Y ++V+E E+ Sbjct: 126 ASNLYKDNRKEYIKRVRETVEK 147
>UBC2_SCHPO (P23566) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (RAD6 homolog) Length = 151 Score = 58.2 bits (139), Expect = 2e-08 Identities = 29/81 (35%), Positives = 46/81 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F + ++HPNV +G +CLD++ WSP +D+ I + LL PN + P N E Sbjct: 68 PLVKFVSTMFHPNV-YANGELCLDILQNRWSPTYDVAAIL-TSIQSLLNDPNNASPANAE 125 Query: 402 AASLMMRDKNAYEQKVKEYCE 340 AA L +K Y ++V++ E Sbjct: 126 AAQLHRENKKEYVRRVRKTVE 146
>UBC2_NECHA (P78717) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 151 Score = 58.2 bits (139), Expect = 2e-08 Identities = 27/82 (32%), Positives = 48/82 (58%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++++HPNV +G +CLD++ WSP +D+ + + LL PN P N E Sbjct: 68 PQVKFISEMFHPNV-YATGELCLDILQNRWSPTYDVAAVL-TSIQSLLNDPNTGSPANVE 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 A++L ++ Y ++V+E E+ Sbjct: 126 ASNLYKDNRKEYTKRVRETVEK 147
>UBE2N_MACFA (Q4R4I1) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 58.2 bits (139), Expect = 2e-08 Identities = 27/62 (43%), Positives = 37/62 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KIYHPNVD+ SG +CLD++ WSP + + + + LL PNP DPL + Sbjct: 67 PKVRFMTKIYHPNVDK-SGRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLAND 124 Query: 402 AA 397 A Sbjct: 125 VA 126
>UB12L_ARATH (Q9ZU75) Probable NEDD8-conjugating enzyme Ubc12-like (EC 6.3.2.-)| (RUB1-conjugating enzyme 2) (RUB1-protein ligase 2) (RUB1 carrier protein 2) Length = 185 Score = 57.8 bits (138), Expect = 2e-08 Identities = 27/77 (35%), Positives = 45/77 (58%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + K+YHPN+D + G+VCL+++ + W P+ + +N L L PN DPLN E Sbjct: 94 PKVKCKTKVYHPNID-LEGNVCLNILREDWKPVLN-INTVIYGLFHLFTEPNYEDPLNHE 151 Query: 402 AASLMMRDKNAYEQKVK 352 AA+++ + +E V+ Sbjct: 152 AAAVLRDNPKTFEYNVR 168
>UBC12_KLULA (Q6CSW8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 57.8 bits (138), Expect = 2e-08 Identities = 28/76 (36%), Positives = 47/76 (61%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + ++IYHPN+D + G+VCL+++ + W+P D+ +I + + L PN DPLN + Sbjct: 92 PVVKCMHRIYHPNID-IDGNVCLNLLREDWTPALDIQSII-IGILFLFHEPNGRDPLNKD 149 Query: 402 AASLMMRDKNAYEQKV 355 AA ++ D +E KV Sbjct: 150 AAKTLIEDPLRFENKV 165
>UBE2N_RAT (Q9EQX9) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 57.4 bits (137), Expect = 3e-08 Identities = 26/62 (41%), Positives = 37/62 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KIYHPNVD++ G +CLD++ WSP + + + + LL PNP DPL + Sbjct: 67 PKVRFMTKIYHPNVDKL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLAND 124 Query: 402 AA 397 A Sbjct: 125 VA 126
>UBE2N_PONPY (Q5R7J6) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 57.4 bits (137), Expect = 3e-08 Identities = 26/62 (41%), Positives = 37/62 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KIYHPNVD++ G +CLD++ WSP + + + + LL PNP DPL + Sbjct: 67 PKVRFMTKIYHPNVDKL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLAND 124 Query: 402 AA 397 A Sbjct: 125 VA 126
>UBE2N_MOUSE (P61089) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 57.4 bits (137), Expect = 3e-08 Identities = 26/62 (41%), Positives = 37/62 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KIYHPNVD++ G +CLD++ WSP + + + + LL PNP DPL + Sbjct: 67 PKVRFMTKIYHPNVDKL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLAND 124 Query: 402 AA 397 A Sbjct: 125 VA 126
>UBE2N_HUMAN (P61088) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 57.4 bits (137), Expect = 3e-08 Identities = 26/62 (41%), Positives = 37/62 (59%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KIYHPNVD++ G +CLD++ WSP + + + + LL PNP DPL + Sbjct: 67 PKVRFMTKIYHPNVDKL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLAND 124 Query: 402 AA 397 A Sbjct: 125 VA 126
>UBC12_ARATH (Q9SDY5) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme 1) (RUB1-protein ligase 1) (RUB1 carrier protein 1) Length = 184 Score = 57.0 bits (136), Expect = 4e-08 Identities = 26/77 (33%), Positives = 45/77 (58%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + K+YHPN+D + G+VCL+++ + W P+ + +N L L PN DPLN + Sbjct: 93 PKVKCKTKVYHPNID-LEGNVCLNILREDWKPVLN-INTVIYGLFHLFTEPNSEDPLNHD 150 Query: 402 AASLMMRDKNAYEQKVK 352 AA+++ + +E V+ Sbjct: 151 AAAVLRDNPKLFETNVR 167
>UB2EC_SPISO (Q95044) Ubiquitin-conjugating enzyme E2-C (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 177 Score = 56.2 bits (134), Expect = 7e-08 Identities = 29/78 (37%), Positives = 48/78 (61%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + FT +HPNVD+ SG++CLD++ + W+ +D+ I + L LL PN + PLN + Sbjct: 94 PVVKFTTPCWHPNVDQ-SGNICLDILKENWTASYDVRTIL-LSLQSLLGEPNNASPLNAQ 151 Query: 402 AASLMMRDKNAYEQKVKE 349 AA M ++ Y++ + E Sbjct: 152 AAD-MWSNQTEYKKVLHE 168
>UB2L6_HUMAN (O14933) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcH8) (Retinoic acid-induced gene B protein) (RIG-B) Length = 152 Score = 55.8 bits (133), Expect = 9e-08 Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVI-NQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNG 406 P I FT KIYHPNVDE +G +CL +I ++ W P + E L L+ PN +PL Sbjct: 65 PMIKFTTKIYHPNVDE-NGQICLPIISSENWKPCTKTCQVLEA-LNVLVNRPNIREPLRM 122 Query: 405 EAASLMMRDKNAYEQKVKEYCERY 334 + A L+ ++ + + +E+ R+ Sbjct: 123 DLADLLTQNPELFRKNAEEFTLRF 146
>UBC16_SCHPO (Q9P6I1) Ubiquitin-conjugating enzyme E2 16 (EC 6.3.2.19)| (Ubiquitin-protein ligase 16) (Ubiquitin carrier protein 16) Length = 160 Score = 55.8 bits (133), Expect = 9e-08 Identities = 32/84 (38%), Positives = 45/84 (53%), Gaps = 1/84 (1%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PS+ F KI HPN+ +G VC+D++ WSP + L + + L Y + S PLN + Sbjct: 69 PSVYFQTKIVHPNISWTNGEVCMDILKTHWSPAWSLQSACLAIISLLSNY-DASSPLNVD 127 Query: 402 AASLMMR-DKNAYEQKVKEYCERY 334 AA L+ DK AY V+ C Y Sbjct: 128 AAKLLRTGDKTAYNSLVR--CTTY 149
>UBE2T_MOUSE (Q9CQ37) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 204 Score = 55.5 bits (132), Expect = 1e-07 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 4/87 (4%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQ----TWSPMFDLVNIFEVFLPQLLLYPNPSDP 415 P + F IYHPN+D SG +CLD++ W P ++ + + L+ PNP DP Sbjct: 66 PQVRFLTPIYHPNIDS-SGRICLDILKLPPKGAWRPSLNIATVL-TSIQLLMAEPNPDDP 123 Query: 414 LNGEAASLMMRDKNAYEQKVKEYCERY 334 L + +S +K A+ +K K++ E + Sbjct: 124 LMADISSEFKYNKIAFLKKAKQWTEAH 150
>UBCX_PICAN (O60015) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 188 Score = 55.1 bits (131), Expect = 1e-07 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = -1 Query: 561 KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAASLM-M 385 K+ HPNV+ +G +CLD++ Q WSP + L + V + LL P P PLN + A+L+ Sbjct: 105 KMPHPNVNFKTGEICLDILQQKWSPAWTLQSAL-VAIVVLLANPEPLSPLNIDMANLLKC 163 Query: 384 RDKNAYEQKVKEYCERY 334 D AY+ V Y +Y Sbjct: 164 DDTTAYKDLVHYYIAKY 180
>UB2E2_MOUSE (Q91W82) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) Length = 201 Score = 55.1 bits (131), Expect = 1e-07 Identities = 25/83 (30%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F +IYH N++ G +CLD++ WSP + + + + LL NP+DPL G Sbjct: 119 PKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCNPADPLVGS 176 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ M ++ +++ +++ +RY Sbjct: 177 IATQYMTNRAEHDRMARQWTKRY 199
>UB2E2_HUMAN (Q96LR5) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) (UbcH8) Length = 201 Score = 55.1 bits (131), Expect = 1e-07 Identities = 25/83 (30%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F +IYH N++ G +CLD++ WSP + + + + LL NP+DPL G Sbjct: 119 PKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCNPADPLVGS 176 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ M ++ +++ +++ +RY Sbjct: 177 IATQYMTNRAEHDRMARQWTKRY 199
>UB2E1_MOUSE (P52482) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcM3) Length = 193 Score = 55.1 bits (131), Expect = 1e-07 Identities = 25/83 (30%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F +IYH N++ G +CLD++ WSP + + + + LL NP+DPL G Sbjct: 111 PKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCNPADPLVGS 168 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ M ++ +++ +++ +RY Sbjct: 169 IATQYMTNRAEHDRMARQWTKRY 191
>UB2E1_HUMAN (P51965) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcH6) Length = 193 Score = 55.1 bits (131), Expect = 1e-07 Identities = 25/83 (30%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F +IYH N++ G +CLD++ WSP + + + + LL NP+DPL G Sbjct: 111 PKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCNPADPLVGS 168 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ M ++ +++ +++ +RY Sbjct: 169 IATQYMTNRAEHDRMARQWTKRY 191
>UB2EC_XENLA (P56616) Ubiquitin-conjugating enzyme X (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UBC-X) Length = 179 Score = 54.7 bits (130), Expect = 2e-07 Identities = 29/82 (35%), Positives = 48/82 (58%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F +HPNVD G++CLD++ WS ++D+ I + L LL PN PLN Sbjct: 94 PTVKFVTPCFHPNVDS-HGNICLDILKDKWSALYDVRTIL-LSLQSLLGEPNNESPLNPY 151 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 AA L +++ AY++ + E ++ Sbjct: 152 AAEL-WQNQTAYKKHLHEQYQK 172
>UBE2C_HUMAN (O00762) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 54.3 bits (129), Expect = 3e-07 Identities = 28/78 (35%), Positives = 47/78 (60%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F YHPNVD G++CLD++ + WS ++D+ I + + LL PN PLN Sbjct: 94 PTVKFLTPCYHPNVDTQ-GNICLDILKEKWSALYDVRTIL-LSIQSLLGEPNIDSPLNTH 151 Query: 402 AASLMMRDKNAYEQKVKE 349 AA L ++ A+++ ++E Sbjct: 152 AAEL-WKNPTAFKKYLQE 168
>UBE2C_MOUSE (Q9D1C1) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 53.5 bits (127), Expect = 4e-07 Identities = 28/78 (35%), Positives = 46/78 (58%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P++ F YHPNVD G++CLD++ WS ++D+ I + + LL PN PLN Sbjct: 94 PTVKFLTPCYHPNVDTQ-GNICLDILKDKWSALYDVRTIL-LSIQSLLGEPNIDSPLNTH 151 Query: 402 AASLMMRDKNAYEQKVKE 349 AA L ++ A+++ ++E Sbjct: 152 AAEL-WKNPTAFKKYLQE 168
>UB2L6_MOUSE (Q9QZU9) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcM8) Length = 152 Score = 53.5 bits (127), Expect = 4e-07 Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVI-NQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNG 406 P++ FT KIYHPNV E G VCL +I N+ W P + E L L+ PN +P+ Sbjct: 65 PTLRFTTKIYHPNVRE-DGLVCLPLISNENWKPYTKPYQVLEA-LNVLVSKPNLEEPVRL 122 Query: 405 EAASLMMRDKNAYEQKVKEYCERY 334 E A L+ ++ + +K +E+ ++ Sbjct: 123 ELADLLTQNPEMFRKKAEEFTLKF 146
>UBE2T_HUMAN (Q9NPD8) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 197 Score = 53.1 bits (126), Expect = 6e-07 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 4/87 (4%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQ----TWSPMFDLVNIFEVFLPQLLLYPNPSDP 415 P I F IYHPN+D +G +CLDV+ W P ++ + + L+ PNP DP Sbjct: 66 PQIRFLTPIYHPNIDS-AGRICLDVLKLPPKGAWRPSLNIATVL-TSIQLLMSEPNPDDP 123 Query: 414 LNGEAASLMMRDKNAYEQKVKEYCERY 334 L + +S +K A+ + +++ E++ Sbjct: 124 LMADISSEFKYNKPAFLKNARQWTEKH 150
>UB2L3_MOUSE (P68037) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcM4) Length = 154 Score = 53.1 bits (126), Expect = 6e-07 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 1/84 (1%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-QTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNG 406 P I F KIYHPN+DE G VCL VI+ + W P + + + L+ P P PL Sbjct: 66 PKITFKTKIYHPNIDE-KGQVCLPVISAENWKPATKTDQVIQSLI-ALVNDPQPEHPLRA 123 Query: 405 EAASLMMRDKNAYEQKVKEYCERY 334 + A +D+ + + +E+ ++Y Sbjct: 124 DLAEEYSKDRKKFCKNAEEFTKKY 147
>UB2L3_HUMAN (P68036) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcH7) (E2-F1) (L-UBC) Length = 154 Score = 53.1 bits (126), Expect = 6e-07 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 1/84 (1%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-QTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNG 406 P I F KIYHPN+DE G VCL VI+ + W P + + + L+ P P PL Sbjct: 66 PKITFKTKIYHPNIDE-KGQVCLPVISAENWKPATKTDQVIQSLI-ALVNDPQPEHPLRA 123 Query: 405 EAASLMMRDKNAYEQKVKEYCERY 334 + A +D+ + + +E+ ++Y Sbjct: 124 DLAEEYSKDRKKFCKNAEEFTKKY 147
>UB2E3_MOUSE (P52483) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcM2) Length = 207 Score = 53.1 bits (126), Expect = 6e-07 Identities = 24/83 (28%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F +IYH N++ G +CLD++ WSP + + + + LL NP+DPL G Sbjct: 125 PKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCNPADPLVGS 182 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ + ++ +++ +++ +RY Sbjct: 183 IATQYLTNRAEHDRIARQWTKRY 205
>UB2E3_HUMAN (Q969T4) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcH9) (UbcM2) Length = 207 Score = 53.1 bits (126), Expect = 6e-07 Identities = 24/83 (28%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F +IYH N++ G +CLD++ WSP + + + + LL NP+DPL G Sbjct: 125 PKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCNPADPLVGS 182 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ + ++ +++ +++ +RY Sbjct: 183 IATQYLTNRAEHDRIARQWTKRY 205
>UBCD2_DROME (P52485) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 232 Score = 52.8 bits (125), Expect = 7e-07 Identities = 24/83 (28%), Positives = 47/83 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F +IYH N++ G +CLD++ WSP + + + + LL NP+DPL G Sbjct: 150 PKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCNPADPLVGS 207 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ ++++ +++ + + +RY Sbjct: 208 IATQYLQNREEHDRIARLWTKRY 230
>UBC2_NEUCR (P52493) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (Mutagen-sensitive protein 8) Length = 151 Score = 52.4 bits (124), Expect = 1e-06 Identities = 25/82 (30%), Positives = 46/82 (56%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 PS+ F ++++HPNV +G +CLD++ WSP +D+ + + LL PN N Sbjct: 68 PSVKFISEMFHPNV-YATGELCLDILQNRWSPTYDVAAVL-TSIQSLLNDPNTGSRANVA 125 Query: 402 AASLMMRDKNAYEQKVKEYCER 337 ++L ++ Y ++V+E E+ Sbjct: 126 PSNLYKDNRKEYHKRVRETVEK 147
>UBC1_MOUSE (P61087) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 50.8 bits (120), Expect = 3e-06 Identities = 22/83 (26%), Positives = 42/83 (50%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KI+HPN+ ++G++CLD++ W+ L + + L LL P DP + Sbjct: 70 PKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVL-LSLQALLAAAEPDDPQDAV 128 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ ++ ++Q + + Y Sbjct: 129 VANQYKQNPEMFKQTARLWAHVY 151
>UBC1_HUMAN (P61086) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 50.8 bits (120), Expect = 3e-06 Identities = 22/83 (26%), Positives = 42/83 (50%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KI+HPN+ ++G++CLD++ W+ L + + L LL P DP + Sbjct: 70 PKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVL-LSLQALLAAAEPDDPQDAV 128 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ ++ ++Q + + Y Sbjct: 129 VANQYKQNPEMFKQTARLWAHVY 151
>UBC1_BOVIN (P61085) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 50.8 bits (120), Expect = 3e-06 Identities = 22/83 (26%), Positives = 42/83 (50%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F KI+HPN+ ++G++CLD++ W+ L + + L LL P DP + Sbjct: 70 PKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVL-LSLQALLAAAEPDDPQDAV 128 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A+ ++ ++Q + + Y Sbjct: 129 VANQYKQNPEMFKQTARLWAHVY 151
>UBC9_CAEEL (Q95017) Ubiquitin-conjugating enzyme E2 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) Length = 166 Score = 50.4 bits (119), Expect = 4e-06 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVI--NQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P F ++HPNV SG+VCL ++ N+ W P + + + + LL +PN DP Sbjct: 73 PKCKFEPPLFHPNVYP-SGTVCLSLLDENKDWKPSISIKQLL-IGIQDLLNHPNIEDPAQ 130 Query: 408 GEAASLMMRDKNAYEQKVKEYCERY 334 EA + +++ YE++VK+ +Y Sbjct: 131 AEAYQIYCQNRAEYEKRVKKEAVKY 155
>UBE2T_XENLA (Q7ZY08) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 192 Score = 49.7 bits (117), Expect = 6e-06 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 4/87 (4%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQ----TWSPMFDLVNIFEVFLPQLLLYPNPSDP 415 P I F IYHPN+D +G +CLD++ W P ++ + + L+ PNP DP Sbjct: 66 PKIRFLTPIYHPNIDS-AGRICLDILKLPPKGAWRPALNISTVL-TSIQLLMSEPNPDDP 123 Query: 414 LNGEAASLMMRDKNAYEQKVKEYCERY 334 L + +S ++ + K++ E++ Sbjct: 124 LMADISSEFKYNRAVFFSNAKKWTEKH 150
>UBC84_DROME (P52487) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 153 Score = 49.3 bits (116), Expect = 8e-06 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-QTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNG 406 P I F KIYHPNVDE G VCL +I+ W P + + L ++ P P PL Sbjct: 66 PKILFKTKIYHPNVDE-KGEVCLPIISTDNWKPTTRTEQVLQA-LVAIVHNPEPEHPLRS 123 Query: 405 EAASLMMRDKNAYEQKVKEYCER 337 + A +R+ + + +E+ ++ Sbjct: 124 DLAEEFVREHKKFMKTAEEFTKK 146
>UBC3_SCHPO (P40984) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase hus5) (Ubiquitin carrier protein hus5) (SUMO protein ligase) (SUMO-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 157 Score = 48.9 bits (115), Expect = 1e-05 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 2/79 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P FT ++HPNV SG+VCL ++N+ W P + I + + LL PN + P Sbjct: 73 PKCRFTPPLFHPNVYP-SGTVCLSILNEEEGWKPAITIKQIL-LGIQDLLDDPNIASPAQ 130 Query: 408 GEAASLMMRDKNAYEQKVK 352 EA ++ +DK YE++V+ Sbjct: 131 TEAYTMFKKDKVEYEKRVR 149
>UBC12_CAEEL (Q9XVK5) NEDD8-conjugating enzyme ubc-12 (EC 6.3.2.-) (NEDD8| protein ligase) (NEDD8 carrier protein) (Ubiquitin-conjugating enzyme E2 12) Length = 180 Score = 48.5 bits (114), Expect = 1e-05 Identities = 24/89 (26%), Positives = 47/89 (52%), Gaps = 6/89 (6%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQT------WSPMFDLVNIFEVFLPQLLLYPNPS 421 P + K++HPN++E GS+CL ++ Q W P +L ++ + + + Sbjct: 92 PVVKCLTKVWHPNINE-DGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFNDLMDFN 150 Query: 420 DPLNGEAASLMMRDKNAYEQKVKEYCERY 334 D LN +AA + +++ ++ +V+EY RY Sbjct: 151 DALNIQAAQMWSQNRESFNHRVREYISRY 179
>UBC9_YEAST (P50623) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 157 Score = 48.1 bits (113), Expect = 2e-05 Identities = 30/85 (35%), Positives = 43/85 (50%), Gaps = 2/85 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN--QTWSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P + F YHPNV SG++CL ++N Q W P L I + + LL PNP+ P Sbjct: 73 PKVKFPAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIV-LGVQDLLDSPNPNSPAQ 130 Query: 408 GEAASLMMRDKNAYEQKVKEYCERY 334 A R+K Y++KV ++Y Sbjct: 131 EPAWRSFSRNKAEYDKKVLLQAKQY 155
>UBE2S_MOUSE (Q921J4) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 223 Score = 48.1 bits (113), Expect = 2e-05 Identities = 22/73 (30%), Positives = 42/73 (57%) Frame = -1 Query: 570 FTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAASL 391 F KI+HPNV +G +C++V+ + W+ + ++ + + LL++PNP LN EA L Sbjct: 79 FLTKIFHPNVGP-NGEICVNVLKRDWTAELGIRHVL-LTIKCLLIHPNPESALNEEAGRL 136 Query: 390 MMRDKNAYEQKVK 352 ++ + Y + + Sbjct: 137 LLENYEEYAARAR 149
>UBE2S_HUMAN (Q16763) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 222 Score = 48.1 bits (113), Expect = 2e-05 Identities = 22/73 (30%), Positives = 42/73 (57%) Frame = -1 Query: 570 FTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAASL 391 F KI+HPNV +G +C++V+ + W+ + ++ + + LL++PNP LN EA L Sbjct: 79 FLTKIFHPNVG-ANGEICVNVLKRDWTAELGIRHVL-LTIKCLLIHPNPESALNEEAGRL 136 Query: 390 MMRDKNAYEQKVK 352 ++ + Y + + Sbjct: 137 LLENYEEYAARAR 149
>UBCX_PICPA (P49428) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 204 Score = 47.8 bits (112), Expect = 2e-05 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = -1 Query: 552 HPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAASLM-MRDK 376 HPN+ +G +CLD++ W+P + L + + LL P P PL+ + A+LM + D Sbjct: 122 HPNIAFNTGEICLDILQAKWTPAWTLSSALTAIV-LLLNDPEPLSPLDIDMANLMKINDL 180 Query: 375 NAYEQKVKEYCERY 334 AY ++ Y RY Sbjct: 181 KAYNSLIEYYVGRY 194
>COP10_ARATH (Q9LJD7) Constitutive photomorphogenesis protein 10| Length = 182 Score = 47.0 bits (110), Expect = 4e-05 Identities = 22/83 (26%), Positives = 43/83 (51%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F +IYH NVD +G + ++++ +WSP + + + + + L P P P Sbjct: 100 PKLVFKTRIYHCNVDT-AGDLSVNILRDSWSPALTITKVLQA-IRSIFLKPEPYSPALPV 157 Query: 402 AASLMMRDKNAYEQKVKEYCERY 334 A L + D+ +++ KE+ R+ Sbjct: 158 IARLYLTDREKHDEVAKEWTLRF 180
>UBC3_YEAST (P14682) Ubiquitin-conjugating enzyme E2-34 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Cell division control protein 34) (E3 ubiquitin ligase complex SCF subunit CDC34) Length = 295 Score = 46.6 bits (109), Expect = 5e-05 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 12/94 (12%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQ------------TWSPMFDLVNIFEVFLPQLL 439 P FT IYHPNV G +C+ +++Q TWSP+ + ++ + + LL Sbjct: 75 PQFRFTPAIYHPNVYR-DGRLCISILHQSGDPMTDEPDAETWSPVQTVESVL-ISIVSLL 132 Query: 438 LYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 PN + P N +AA ++ Y+Q+VK ER Sbjct: 133 EDPNINSPANVDAAVDYRKNPEQYKQRVKMEVER 166
>UBC21_CAEEL (P52484) Probable ubiquitin-conjugating enzyme E2 21 (EC 6.3.2.19)| (Ubiquitin-protein ligase 21) (Ubiquitin carrier protein 21) Length = 260 Score = 46.6 bits (109), Expect = 5e-05 Identities = 19/58 (32%), Positives = 32/58 (55%) Frame = -1 Query: 570 FTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAA 397 F +I+HPN+ +G++CLD++ W+ L + + L +L P PSDP + A Sbjct: 104 FVTRIWHPNISSQTGTICLDILKDKWTASLTLRTVL-LSLQAMLCSPEPSDPQDAVVA 160
>UBCD4_DROME (P52486) Ubiquitin-conjugating enzyme E2-22 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 199 Score = 46.2 bits (108), Expect = 7e-05 Identities = 19/62 (30%), Positives = 33/62 (53%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F +I+HPN+ ++G++CLD++ W+ L + + L LL P DP + Sbjct: 71 PKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVL-LSLQALLAAAEPDDPQDAV 129 Query: 402 AA 397 A Sbjct: 130 VA 131
>UBE2I_XENLA (P63282) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 45.8 bits (107), Expect = 9e-05 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P F ++HPNV SG+VCL ++ + W P + I + + +LL PN DP Sbjct: 73 PKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQELLNEPNIQDPAQ 130 Query: 408 GEAASLMMRDKNAYEQKVKEYCERY 334 EA ++ +++ YE++V+ +++ Sbjct: 131 AEAYTIYCQNRVEYEKRVRAQAKKF 155
>UBE2I_RAT (P63281) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin-conjugating enzyme UbcE2A) Length = 158 Score = 45.8 bits (107), Expect = 9e-05 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P F ++HPNV SG+VCL ++ + W P + I + + +LL PN DP Sbjct: 73 PKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQELLNEPNIQDPAQ 130 Query: 408 GEAASLMMRDKNAYEQKVKEYCERY 334 EA ++ +++ YE++V+ +++ Sbjct: 131 AEAYTIYCQNRVEYEKRVRAQAKKF 155
>UBE2I_MOUSE (P63280) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (mUBC9) Length = 158 Score = 45.8 bits (107), Expect = 9e-05 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P F ++HPNV SG+VCL ++ + W P + I + + +LL PN DP Sbjct: 73 PKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQELLNEPNIQDPAQ 130 Query: 408 GEAASLMMRDKNAYEQKVKEYCERY 334 EA ++ +++ YE++V+ +++ Sbjct: 131 AEAYTIYCQNRVEYEKRVRAQAKKF 155
>UBE2I_HUMAN (P63279) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (p18) Length = 158 Score = 45.8 bits (107), Expect = 9e-05 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P F ++HPNV SG+VCL ++ + W P + I + + +LL PN DP Sbjct: 73 PKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQELLNEPNIQDPAQ 130 Query: 408 GEAASLMMRDKNAYEQKVKEYCERY 334 EA ++ +++ YE++V+ +++ Sbjct: 131 AEAYTIYCQNRVEYEKRVRAQAKKF 155
>UBE2I_CHICK (P63283) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 45.8 bits (107), Expect = 9e-05 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P F ++HPNV SG+VCL ++ + W P + I + + +LL PN DP Sbjct: 73 PKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQELLNEPNIQDPAQ 130 Query: 408 GEAASLMMRDKNAYEQKVKEYCERY 334 EA ++ +++ YE++V+ +++ Sbjct: 131 AEAYTIYCQNRVEYEKRVRAQAKKF 155
>UBE2U_MACFA (Q95LM1) Ubiquitin-conjugating enzyme E2 U (EC 6.3.2.19)| (Ubiquitin-protein ligase U) (Ubiquitin carrier protein U) Length = 322 Score = 43.5 bits (101), Expect = 4e-04 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 2/79 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN--QTWSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P + F +HPNVD +G C+D ++ + W+ + L +I + L +L P +P+N Sbjct: 68 PVVKFVTIPFHPNVDPHTGQPCIDFLDNPKKWNTNYTLSSIL-LALQVMLSNPVLENPVN 126 Query: 408 GEAASLMMRDKNAYEQKVK 352 EAA ++ +D++ Y +K Sbjct: 127 LEAARILTKDESLYRTILK 145
>UBE2U_HUMAN (Q5VVX9) Ubiquitin-conjugating enzyme E2 U (EC 6.3.2.19)| (Ubiquitin-protein ligase U) (Ubiquitin carrier protein U) Length = 321 Score = 43.5 bits (101), Expect = 4e-04 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 2/74 (2%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN--QTWSPMFDLVNIFEVFLPQLLLYPNPSDPLN 409 P + F +HPNVD +G C+D ++ + W+ + L +I + L +L P +P+N Sbjct: 68 PVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTNYTLSSIL-LALQVMLSNPVLENPVN 126 Query: 408 GEAASLMMRDKNAY 367 EAA ++++D++ Y Sbjct: 127 LEAARILVKDESLY 140
>UBC_ASFM2 (P25869) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 213 Score = 41.2 bits (95), Expect = 0.002 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 13/91 (14%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN--------QTWSPMFDLVNIFEVFLPQLLLYPN 427 P + FT++++HPN+ G +C+ +++ TWSP + + + + LL PN Sbjct: 65 PRLTFTSEMWHPNI-YSDGKLCISILHGDNAEEQGMTWSPAQKIDTVL-LSVISLLNEPN 122 Query: 426 PSDPLNGEAAS-----LMMRDKNAYEQKVKE 349 P P N +AA L D +Y +VK+ Sbjct: 123 PDSPANVDAAKSYRKYLYKEDLESYPMEVKK 153
>UB2G1_RAT (P62255) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 40.0 bits (92), Expect = 0.005 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 13/95 (13%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDLVNIFEVFLPQL 442 P + F +I+HPNVD+ +G VC+ +++ + W P+ + I + + + Sbjct: 69 PKMKFITEIWHPNVDK-NGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIM-ISVISM 126 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 L PN P N +AA D+N ++ C R Sbjct: 127 LADPNGDSPANVDAAKEWREDRNGEFKRKVARCVR 161
>UB2G1_MOUSE (P62254) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 40.0 bits (92), Expect = 0.005 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 13/95 (13%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDLVNIFEVFLPQL 442 P + F +I+HPNVD+ +G VC+ +++ + W P+ + I + + + Sbjct: 69 PKMKFITEIWHPNVDK-NGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIM-ISVISM 126 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 L PN P N +AA D+N ++ C R Sbjct: 127 LADPNGDSPANVDAAKEWREDRNGEFKRKVARCVR 161
>UB2G1_HUMAN (P62253) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 40.0 bits (92), Expect = 0.005 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 13/95 (13%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDLVNIFEVFLPQL 442 P + F +I+HPNVD+ +G VC+ +++ + W P+ + I + + + Sbjct: 69 PKMKFITEIWHPNVDK-NGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIM-ISVISM 126 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 L PN P N +AA D+N ++ C R Sbjct: 127 LADPNGDSPANVDAAKEWREDRNGEFKRKVARCVR 161
>UBC_ASFB7 (P27949) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 40.0 bits (92), Expect = 0.005 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 13/91 (14%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN--------QTWSPMFDLVNIFEVFLPQLLLYPN 427 P + FT++++HPN+ G +C+ +++ TWSP + I + + LL PN Sbjct: 65 PKLTFTSEMWHPNI-YPDGRLCISILHGDNAEEQGMTWSPAQKIDTIL-LSVISLLNEPN 122 Query: 426 PSDPLNGEAAS-----LMMRDKNAYEQKVKE 349 P P N +AA + D +Y +VK+ Sbjct: 123 PDSPANVDAAKSYRKYVYKEDLESYPMEVKK 153
>UBC13_ARATH (Q42541) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 166 Score = 39.7 bits (91), Expect = 0.006 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 13/89 (14%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFDLVNIFEVFLPQL 442 P++ FT+ I+HPNV G VC+ ++ ++ W+P+ + +I + + + Sbjct: 69 PTVRFTSDIWHPNV-YPDGRVCISILHPPGDDPSGYELASERWTPVHTVESIM-LSIISM 126 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKV 355 L PN P N EAA ++ +++KV Sbjct: 127 LSGPNDESPANVEAAKEWREKRDEFKKKV 155
>UBC7_CAEEL (P34477) Probable ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 164 Score = 39.3 bits (90), Expect = 0.008 Identities = 23/95 (24%), Positives = 47/95 (49%), Gaps = 13/95 (13%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDLVNIFEVFLPQL 442 P + F ++I+HPN+D+ G+VC+ +++ + W P+ + I + + + Sbjct: 68 PKMKFISEIWHPNIDK-EGNVCISILHDPGDDKWGYERPEERWLPVHTVETIL-LSVISM 125 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 L PN P N +AA + + +++KV + R Sbjct: 126 LTDPNFESPANVDAAKMQRENYAEFKKKVAQCVRR 160
>UBC14_ARATH (P42747) Ubiquitin-conjugating enzyme E2 14 (EC 6.3.2.19)| (Ubiquitin-protein ligase 14) (Ubiquitin carrier protein 14) (TAYO29) Length = 167 Score = 38.9 bits (89), Expect = 0.011 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 13/95 (13%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFDLVNIFEVFLPQL 442 P++ FT++++HPNV G VC+ ++ ++ W+P+ + +I + + + Sbjct: 70 PTVTFTSEMWHPNV-YSDGKVCISILHPPGDDPHGYELASERWTPVHTVESIV-LSIISM 127 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 L PN P N EAA ++ + +KV R Sbjct: 128 LSGPNDESPANVEAAKEWRDNRAEFRKKVSRCVRR 162
>UBC7_WHEAT (P25868) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 168 Score = 38.1 bits (87), Expect = 0.019 Identities = 23/89 (25%), Positives = 47/89 (52%), Gaps = 12/89 (13%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCL------------DVINQTWSPMFDLVNIFEVFLPQLL 439 P++ FT++++HPNV G VC+ ++ ++ W+P+ + +I + + +L Sbjct: 72 PTVRFTSEMWHPNV-YPDGRVCISIHPPGDDPNGYELASERWTPVHTVESIV-LSIISML 129 Query: 438 LYPNPSDPLNGEAASLMMRDKNAYEQKVK 352 PN P N EAA ++ +++KV+ Sbjct: 130 SSPNDESPANIEAAKDWREKQDEFKKKVR 158
>UBC15_SCHPO (Q9Y818) Ubiquitin-conjugating enzyme E2 15 (EC 6.3.2.19)| (Ubiquitin-protein ligase 15) (Ubiquitin carrier protein 15) Length = 167 Score = 38.1 bits (87), Expect = 0.019 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 12/94 (12%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLP------------QLL 439 P + FT +I+HPNV +G VC+ +++ + + E +LP +L Sbjct: 70 PKMKFTTEIWHPNV-HPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILISVISML 128 Query: 438 LYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 PN P N +AA + ++++V+ R Sbjct: 129 SSPNDESPANIDAAKEFRENPQEFKKRVRRLVRR 162
>UBC7_ARATH (Q42540) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 166 Score = 38.1 bits (87), Expect = 0.019 Identities = 23/89 (25%), Positives = 45/89 (50%), Gaps = 13/89 (14%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFDLVNIFEVFLPQL 442 P++ FT+ ++HPNV G VC+ ++ ++ W+P+ + +I + + + Sbjct: 69 PTVRFTSDMWHPNV-YSDGRVCISILHPPGDDPSGYELASERWTPVHTVESIM-LSIISM 126 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKV 355 L PN P N EAA ++ +++KV Sbjct: 127 LSGPNDESPANVEAAKEWRDKRDEFKKKV 155
>UB2G2_PONPY (Q5RF84) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 33.1 bits (74), Expect = 0.60 Identities = 20/95 (21%), Positives = 44/95 (46%), Gaps = 13/95 (13%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDLVNIFEVFLPQL 442 P + FT +++HPN+ G VC+ +++ + WSP+ + I + + + Sbjct: 69 PKMRFTCEMFHPNI-YPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL-LSVVSM 126 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 L PN N +A+ + D+ + + K+ ++ Sbjct: 127 LAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161
>UB2G2_MOUSE (P60605) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 33.1 bits (74), Expect = 0.60 Identities = 20/95 (21%), Positives = 44/95 (46%), Gaps = 13/95 (13%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDLVNIFEVFLPQL 442 P + FT +++HPN+ G VC+ +++ + WSP+ + I + + + Sbjct: 69 PKMRFTCEMFHPNI-YPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL-LSVVSM 126 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 L PN N +A+ + D+ + + K+ ++ Sbjct: 127 LAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161
>UB2G2_HUMAN (P60604) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 33.1 bits (74), Expect = 0.60 Identities = 20/95 (21%), Positives = 44/95 (46%), Gaps = 13/95 (13%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDLVNIFEVFLPQL 442 P + FT +++HPN+ G VC+ +++ + WSP+ + I + + + Sbjct: 69 PKMRFTCEMFHPNI-YPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL-LSVVSM 126 Query: 441 LLYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCER 337 L PN N +A+ + D+ + + K+ ++ Sbjct: 127 LAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161
>FTS1_HUMAN (Q9H8T0) Fused toes protein homolog (Ft1)| Length = 292 Score = 30.8 bits (68), Expect = 3.0 Identities = 19/76 (25%), Positives = 35/76 (46%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++HP VD SG + + W + + ++ ++ + + PLN E Sbjct: 138 PRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASPLNPE 197 Query: 402 AASLMMRDKNAYEQKV 355 AA L +D ++ KV Sbjct: 198 AAVLYEKDIQLFKSKV 213
>FTS1_MOUSE (Q64362) Fused toes protein (FT1)| Length = 292 Score = 30.4 bits (67), Expect = 3.9 Identities = 19/76 (25%), Positives = 35/76 (46%) Frame = -1 Query: 582 PSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGE 403 P + F ++HP VD SG + + W + + ++ ++ + + PLN E Sbjct: 138 PRLLFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTTSPLNPE 197 Query: 402 AASLMMRDKNAYEQKV 355 AA L +D ++ KV Sbjct: 198 AAVLYEKDIQLFKSKV 213 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,483,958 Number of Sequences: 219361 Number of extensions: 1224515 Number of successful extensions: 3317 Number of sequences better than 10.0: 141 Number of HSP's better than 10.0 without gapping: 2999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3138 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
