>KCNQ4_HUMAN (P56696) Potassium voltage-gated channel subfamily KQT member 4|
           (Voltage-gated potassium channel subunit Kv7.4)
           (Potassium channel alpha subunit KvLQT4) (KQT-like 4)
          Length = 695

 Score = 30.8 bits (68), Expect = 2.8
 Identities = 16/34 (47%), Positives = 19/34 (55%)
 Frame = -1

Query: 377 PGGW*FSPRVLKFIHTMPCCLWSVLTTEQEGQEL 276
           P GW F   V  F+    C + SVL+T QE QEL
Sbjct: 94  PRGWAFVYHVFIFLLVFSCLVLSVLSTIQEHQEL 127


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 73,574,546
Number of Sequences: 219361
Number of extensions: 1410703
Number of successful extensions: 2484
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2441
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2482
length of database: 80,573,946
effective HSP length: 106
effective length of database: 57,321,680
effective search space used: 4643056080
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)