| Clone Name | rbasd16e21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | U171_DROME (Q9VUB4) Hypothetical UPF0171 protein CG8783 | 29 | 9.8 |
|---|
>U171_DROME (Q9VUB4) Hypothetical UPF0171 protein CG8783| Length = 610 Score = 29.3 bits (64), Expect = 9.8 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = +2 Query: 335 VWLISY-LLVVVQNQVGMLQT-DELNQNFSLKHQAGQKVPSEVTDH-PKFEFLHGDMVRI 505 +W++ + LL+ + V + + DE + S + + E D P + LHG M+ + Sbjct: 398 IWMLQHHLLMQLHTYVQFMPSEDEFGDSASCSNHLRDAISDEEGDQEPDADELHGSMLSM 457 Query: 506 LHHPYLTPTLLADHKKR 556 HP P +L +R Sbjct: 458 SSHPLPVPAVLVGGHRR 474 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,411,780 Number of Sequences: 219361 Number of extensions: 1872732 Number of successful extensions: 4349 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4346 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)