Clone Name | rbasd15p13 |
---|---|
Clone Library Name | barley_pub |
>SCFD2_HUMAN (Q8WU76) Sec1 family domain-containing protein 2 (Syntaxin-binding| protein 1-like 1) Length = 684 Score = 49.3 bits (116), Expect = 1e-05 Identities = 37/111 (33%), Positives = 61/111 (54%), Gaps = 2/111 (1%) Frame = -2 Query: 613 TDSYSRKGLLYKLILAVL--TRFDIPGLEYHSSAVGRLFKSGLGRFGLGQSKPNFGDQSF 440 T S K LL +++ + R D +E+ SS + L K+G F + S+P+ D Sbjct: 567 THQASYKPLLKQVVEEIFHPERPDSVDIEHMSSGLTDLLKTGFSMF-MKVSRPHPSDYPL 625 Query: 439 LIVFVVGGINTLEVREVMKAISESGRPDVQLILGGTTLLTPDDMFELMLGS 287 LI+FVVGG+ EV+ ++K + S +P Q+I+ T LL P ++ EL+ + Sbjct: 626 LILFVVGGVTVSEVK-MVKDLVASLKPGTQVIVLSTRLLKPLNIPELLFAT 675
>SCFD2_MOUSE (Q8BTY8) Sec1 family domain-containing protein 2 (Syntaxin-binding| protein 1-like 1) (Neuronal Sec1) Length = 684 Score = 46.6 bits (109), Expect = 8e-05 Identities = 34/111 (30%), Positives = 60/111 (54%), Gaps = 2/111 (1%) Frame = -2 Query: 613 TDSYSRKGLLYKLILAVLT--RFDIPGLEYHSSAVGRLFKSGLGRFGLGQSKPNFGDQSF 440 T S K LL +++ + + D +E+ SS + L K+G F + S+P+ D Sbjct: 567 THQASYKPLLKQVVEEIFNPEKSDPIDIEHMSSGLTDLLKTGFSMF-MKVSRPHPSDHPL 625 Query: 439 LIVFVVGGINTLEVREVMKAISESGRPDVQLILGGTTLLTPDDMFELMLGS 287 LI+FVVGG+ E + ++K + S +P Q+++ T LL P ++ EL+ + Sbjct: 626 LILFVVGGVTVAEAK-MVKDLVASLKPGTQVMVLSTRLLKPLNIPELLFAT 675
>STXB3_HUMAN (O00186) Syntaxin-binding protein 3 (UNC-18 homolog 3) (UNC-18C)| (UNC-18-3) (Platelet Sec1 protein) (PSP) Length = 592 Score = 32.3 bits (72), Expect = 1.6 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -2 Query: 445 SFLIVFVVGGINTLEVREVMKAISESGRPDVQLILGGTTLLTPDDMFE 302 S LIVFV+GGI EVR + ++I+G T +LTP + + Sbjct: 529 SKLIVFVIGGITYSEVRGAYEV--SQAHKSCEVIIGSTHVLTPKKLLD 574
>STXB1_RAT (P61765) Syntaxin-binding protein 1 (Unc-18 homolog) (Unc-18A)| (Unc-18-1) (N-Sec1) (rbSec1) (p67) Length = 594 Score = 32.0 bits (71), Expect = 2.1 Identities = 14/48 (29%), Positives = 30/48 (62%) Frame = -2 Query: 439 LIVFVVGGINTLEVREVMKAISESGRPDVQLILGGTTLLTPDDMFELM 296 LI+F++GG++ E+R + +G+ +V ++G T +LTP + + + Sbjct: 537 LIIFILGGVSLNEMRCAYEVTQANGKWEV--LIGSTHILTPQKLLDTL 582
>STXB1_MOUSE (O08599) Syntaxin-binding protein 1 (Unc-18 homolog) (Unc-18A)| (Unc-18-1) Length = 594 Score = 32.0 bits (71), Expect = 2.1 Identities = 14/48 (29%), Positives = 30/48 (62%) Frame = -2 Query: 439 LIVFVVGGINTLEVREVMKAISESGRPDVQLILGGTTLLTPDDMFELM 296 LI+F++GG++ E+R + +G+ +V ++G T +LTP + + + Sbjct: 537 LIIFILGGVSLNEMRCAYEVTQANGKWEV--LIGSTHILTPQKLLDTL 582
>STXB1_HUMAN (P61764) Syntaxin-binding protein 1 (Unc-18 homolog) (Unc-18A)| (Unc-18-1) (N-Sec1) (p67) Length = 594 Score = 32.0 bits (71), Expect = 2.1 Identities = 14/48 (29%), Positives = 30/48 (62%) Frame = -2 Query: 439 LIVFVVGGINTLEVREVMKAISESGRPDVQLILGGTTLLTPDDMFELM 296 LI+F++GG++ E+R + +G+ +V ++G T +LTP + + + Sbjct: 537 LIIFILGGVSLNEMRCAYEVTQANGKWEV--LIGSTHILTPQKLLDTL 582
>STXB1_BOVIN (P61763) Syntaxin-binding protein 1 (Unc-18 homolog) (Unc-18A)| (Unc-18-1) (N-Sec1) (p67) Length = 594 Score = 32.0 bits (71), Expect = 2.1 Identities = 14/48 (29%), Positives = 30/48 (62%) Frame = -2 Query: 439 LIVFVVGGINTLEVREVMKAISESGRPDVQLILGGTTLLTPDDMFELM 296 LI+F++GG++ E+R + +G+ +V ++G T +LTP + + + Sbjct: 537 LIIFILGGVSLNEMRCAYEVTQANGKWEV--LIGSTHILTPQKLLDTL 582
>UBP11_MOUSE (Q99K46) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 797 Score = 31.6 bits (70), Expect = 2.7 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 4/66 (6%) Frame = -2 Query: 532 YHSSAVGRLFKSGLGRFGLGQSKPNFGDQSFLIVFVVGGI----NTLEVREVMKAISESG 365 YH S V +FK+ +G F D L+ F++ G+ N ++ +E ++ + +G Sbjct: 197 YHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCNGAG 256 Query: 364 RPDVQL 347 RPD+++ Sbjct: 257 RPDLEV 262
>HERC5_HUMAN (Q9UII4) HECT domain and RCC1-like domain-containing protein 5| (Cyclin-E-binding protein 1) Length = 1024 Score = 30.0 bits (66), Expect = 7.9 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Frame = -2 Query: 619 FETDSYSRKGLLYKLILAVLTRFDIPGLEYHSSAV---GRLFKSGL---GRFGLGQSKPN 458 FE D+YS K L ++ IL I +YHS A+ G LF G G+ G+G+ P+ Sbjct: 119 FEYDNYSMKHLRFESILQEKKIIQITCGDYHSLALSKGGELFAWGQNLHGQLGVGRKFPS 178
>NHR49_CAEEL (O45666) Nuclear hormone receptor family member nhr-49| Length = 501 Score = 30.0 bits (66), Expect = 7.9 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +3 Query: 285 DEPNINSNMSSGVRRVVPPRMSCTSGLPLSEIAFMTSRTSRVLMPPTTKTM 437 ++ +I SG PP CT+ + L+EI SRT+ +LM KT+ Sbjct: 196 NDTDIQQGSDSGASAFAPPNRPCTTEVDLNEI----SRTTLLLMVEWAKTI 242
>VPS45_RAT (O08700) Vacuolar protein sorting-associated protein 45 (rvps45)| Length = 570 Score = 30.0 bits (66), Expect = 7.9 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = -2 Query: 439 LIVFVVGGINTLEVREVMKAISESGRPDVQLILGGTTLLTPDDMFELMLGS 287 +IVFV+GG E V + P V+++LGGTT+ E +L S Sbjct: 502 IIVFVIGGATYEEALTVYNLNRTT--PGVRIVLGGTTIHNTKSFLEEVLAS 550
>STXB3_MOUSE (Q60770) Syntaxin-binding protein 3 (UNC-18 homolog 3) (UNC-18C)| (MUNC-18-3) Length = 592 Score = 30.0 bits (66), Expect = 7.9 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -2 Query: 445 SFLIVFVVGGINTLEVREVMKAISESGRPDVQLILGGTTLLTPDDMFE 302 S LI+FV+GGI E+R + ++I+G T +LTP + + Sbjct: 530 SRLIIFVIGGITYSEMRCAYEV--SQAHKSCEVIIGSTHILTPRKLLD 575 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,176,070 Number of Sequences: 219361 Number of extensions: 2013976 Number of successful extensions: 4471 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 4388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4465 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7819576386 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)