Clone Name | rbasd16e18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RUVB_ZYMMO (Q5NR72) Holliday junction ATP-dependent DNA helicase... | 31 | 2.4 | 2 | AROB_NITMU (Q2YB61) 3-dehydroquinate synthase (EC 4.2.3.4) | 31 | 2.4 | 3 | RAD17_MOUSE (Q6NXW6) Cell cycle checkpoint protein RAD17 | 29 | 9.3 |
---|
>RUVB_ZYMMO (Q5NR72) Holliday junction ATP-dependent DNA helicase ruvB (EC| 3.6.1.-) Length = 347 Score = 31.2 bits (69), Expect = 2.4 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 537 ARGRALNGLGWPPFRFTNPRETPNTGRH 454 ARGR LNGL W T+PRE G+H Sbjct: 312 ARGRQLNGLAWRHLGLTDPREA--EGKH 337
>AROB_NITMU (Q2YB61) 3-dehydroquinate synthase (EC 4.2.3.4)| Length = 366 Score = 31.2 bits (69), Expect = 2.4 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 118 SILTSDISRSCHQKPSPIDRTSRY*HLKKLLSRSRRFGESLE 243 SILT I RSC K ++ R ++ LL+ FG ++E Sbjct: 217 SILTDAIKRSCQHKAEVVEEDERESGMRALLNLGHTFGHAIE 258
>RAD17_MOUSE (Q6NXW6) Cell cycle checkpoint protein RAD17| Length = 688 Score = 29.3 bits (64), Expect = 9.3 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = -3 Query: 479 GKLRIQAVILSTDRLIGC*DPKSRGKQPRSYAKVPKQSLSGKGSDRAMTTRRWAWKQPSF 300 G+L+++A+ TDR +G DP S + P S + P Q G+ + A W P Sbjct: 592 GRLKMEAL---TDRELGLIDPDSGDESPHSGGQ-PAQEAPGEPAQAAQNADPETWSLPLS 647 Query: 299 EES 291 + S Sbjct: 648 QNS 650 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,825,275 Number of Sequences: 219361 Number of extensions: 1866009 Number of successful extensions: 4220 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4218 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)