| Clone Name | rbasd16e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCNL4_MOUSE (Q8CCA0) DCN1-like protein 4 (Defective in cullin ne... | 30 | 4.8 | 2 | DCNL4_HUMAN (Q92564) DCN1-like protein 4 (Defective in cullin ne... | 30 | 4.8 | 3 | LAML2_CAEEL (Q21313) Laminin-like protein K08C7.3 precursor | 30 | 8.2 |
|---|
>DCNL4_MOUSE (Q8CCA0) DCN1-like protein 4 (Defective in cullin neddylation| protein 1-like protein 4) (DCUN1 domain-containing protein 4) Length = 292 Score = 30.4 bits (67), Expect = 4.8 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -1 Query: 126 TAPCRLNLVINRALGKIAPLMPVYYSYLEE 37 TA C L L+ LGKI PL PV++ +LE+ Sbjct: 216 TAKCMLGLL----LGKIWPLFPVFHQFLEQ 241
>DCNL4_HUMAN (Q92564) DCN1-like protein 4 (Defective in cullin neddylation| protein 1-like protein 4) (DCUN1 domain-containing protein 4) Length = 292 Score = 30.4 bits (67), Expect = 4.8 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -1 Query: 126 TAPCRLNLVINRALGKIAPLMPVYYSYLEE 37 TA C L L+ LGKI PL PV++ +LE+ Sbjct: 216 TAKCMLGLL----LGKIWPLFPVFHQFLEQ 241
>LAML2_CAEEL (Q21313) Laminin-like protein K08C7.3 precursor| Length = 3672 Score = 29.6 bits (65), Expect = 8.2 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 73 CNFTQCSVNNQIKPTRCCYPML--CYLLQFRQAAGHC 177 C+ QC+ NN + +R C+P CYL + HC Sbjct: 1934 CSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHC 1970 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,491,166 Number of Sequences: 219361 Number of extensions: 1984835 Number of successful extensions: 5102 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5100 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)