Clone Name | rbasd16d13 |
---|---|
Clone Library Name | barley_pub |
>RPOC_ENTFA (Q82Z41) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1217 Score = 29.6 bits (65), Expect = 4.3 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 13/95 (13%) Frame = +1 Query: 145 QLTIRGKKKITTYTSFFITEVLIN*TPLLQYSSPYILPSTDPQLEKSIRRLLC--TYLLN 318 ++TI+GK TYT + + + ++ +P S DP+ +R +L YLL Sbjct: 991 EVTIKGKTDTRTYTVPYTARMKVAEGDIIHRGAPLTEGSIDPKQLLQVRDVLSVENYLLR 1050 Query: 319 QVAR-----------RHYDNCIKDLNQERTCEDPG 390 +V R +H + ++ + ++ DPG Sbjct: 1051 EVQRVYRMQGVEIGDKHIEVMVRQMLRKIRVMDPG 1085
>CAC1A_HUMAN (O00555) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2505 Score = 28.9 bits (63), Expect = 7.3 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +1 Query: 223 PLLQYSSPYILPSTDPQLEKSIRRLLCTYLLNQVARRHYDNCI 351 P+ YSS +IL +T+P R LC Y+LN R+++ CI Sbjct: 1217 PMPPYSSMFILSTTNP------LRRLCHYILN---LRYFEMCI 1250
>CAC1A_RABIT (P27884) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2424 Score = 28.9 bits (63), Expect = 7.3 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +1 Query: 223 PLLQYSSPYILPSTDPQLEKSIRRLLCTYLLNQVARRHYDNCI 351 P+ YSS +IL +T+P R LC Y+LN R+++ CI Sbjct: 1226 PMPPYSSMFILSTTNP------LRRLCHYILN---LRYFEMCI 1259
>CAC1A_MOUSE (P97445) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2164 Score = 28.9 bits (63), Expect = 7.3 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +1 Query: 223 PLLQYSSPYILPSTDPQLEKSIRRLLCTYLLNQVARRHYDNCI 351 P+ YSS +IL +T+P R LC Y+LN R+++ CI Sbjct: 1120 PMPPYSSMFILSTTNP------LRRLCHYILN---LRYFEMCI 1153
>CAC1A_RAT (P54282) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide, isoform 4) (Brain calcium channel I) (BI) (RAT brain class A) (RBA-I) Length = 2212 Score = 28.9 bits (63), Expect = 7.3 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +1 Query: 223 PLLQYSSPYILPSTDPQLEKSIRRLLCTYLLNQVARRHYDNCI 351 P+ YSS +IL +T+P R LC Y+LN R+++ CI Sbjct: 1168 PMPPYSSMFILSTTNP------LRRLCHYILN---LRYFEMCI 1201 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,182,155 Number of Sequences: 219361 Number of extensions: 1232466 Number of successful extensions: 2738 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2738 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)