| Clone Name | rbasd15o12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FRAS1_MOUSE (Q80T14) Extracellular matrix protein FRAS1 precursor | 29 | 3.0 | 2 | FRAS1_HUMAN (Q86XX4) Extracellular matrix protein FRAS1 precursor | 29 | 3.9 |
|---|
>FRAS1_MOUSE (Q80T14) Extracellular matrix protein FRAS1 precursor| Length = 4010 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Frame = -2 Query: 172 GFGIMRASLCCVLCLXQAXTC-----CVDCLPP 89 G G +A C+ C Q TC C CLPP Sbjct: 454 GLGFYQAGSLCLACQPQCSTCTNGLECSSCLPP 486
>FRAS1_HUMAN (Q86XX4) Extracellular matrix protein FRAS1 precursor| Length = 4007 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/39 (33%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = -2 Query: 190 WAHGXSGFGIMRASLCCVLCLXQAXTC-----CVDCLPP 89 W G G +A C+ C Q TC C C PP Sbjct: 449 WCVHSCGLGFYQAGSLCLACQPQCSTCTSGLECSSCQPP 487 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,291,447 Number of Sequences: 219361 Number of extensions: 238762 Number of successful extensions: 459 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)