Clone Name | rbasd16d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DMP1_BOVIN (Q95120) Dentin matrix acidic phosphoprotein 1 precur... | 31 | 2.7 |
---|
>DMP1_BOVIN (Q95120) Dentin matrix acidic phosphoprotein 1 precursor (Dentin| matrix protein 1) (DMP-1) Length = 510 Score = 31.2 bits (69), Expect = 2.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -1 Query: 630 GKDFLDDGTSVEFMQDALKQPTAGLGGLGLARHPSKGK 517 G+ LDD ++E M D+ + P + GLG +R SK + Sbjct: 279 GRGELDDSRTIEVMSDSTENPDSKEAGLGQSREHSKSE 316 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,595,044 Number of Sequences: 219361 Number of extensions: 1891836 Number of successful extensions: 4362 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4362 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)