Clone Name | rbasd15n06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ALGI_AZOVI (O52196) Probable poly(beta-D-mannuronate) O-acetylas... | 31 | 2.4 |
---|
>ALGI_AZOVI (O52196) Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-)| (Alginate biosynthesis protein algI) Length = 499 Score = 31.2 bits (69), Expect = 2.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -1 Query: 377 HGGWLINQSRLWLDSAAYVIRLCIWVLVYLFVRLGGLYTR 258 HG WL + L +D+A IR WV +L V +G + R Sbjct: 335 HGTWLAIERALRIDAAPKTIRPLRWVFAFLLVMVGWVIFR 374 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,451,136 Number of Sequences: 219361 Number of extensions: 1746354 Number of successful extensions: 5050 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4890 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)