Clone Name | rbasd15m19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CUED1_MOUSE (Q8R3V6) CUE domain-containing protein 1 | 31 | 4.6 |
---|
>CUED1_MOUSE (Q8R3V6) CUE domain-containing protein 1| Length = 388 Score = 30.8 bits (68), Expect = 4.6 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -1 Query: 178 IQIEKLT*MLSGENIHKGAE*NQNFMFGFELETLKIINQRRL*PLAFQANDAGFDSRYP 2 ++ E++ L E K + N++F+ E + LK +Q+ A ND GF S P Sbjct: 233 LEDERIALFLQNEEFMKELQRNRDFLLALERDRLKYESQKSKSNYAAVGNDGGFPSSVP 291 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,195,307 Number of Sequences: 219361 Number of extensions: 1809332 Number of successful extensions: 3090 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3089 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7762912789 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)