Clone Name | rbasd16b04 |
---|---|
Clone Library Name | barley_pub |
>RFBX_ECOLI (P37746) Putative O-antigen transporter| Length = 415 Score = 36.2 bits (82), Expect = 0.082 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 483 HCVLFW*VKPQLIGGLQQPDWMGERSEAMNWSSVSFLSSR 602 H V+ W P L+G L P W+ + E M W ++S + SR Sbjct: 116 HAVIIWSFVPALVGNLIYPIWLFQGKEKMKWLTLSSILSR 155
>RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-2) Length = 1558 Score = 31.2 bits (69), Expect = 2.6 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -2 Query: 526 PPISCGFTYQNSTQWTGPAKSTEPDCSAWSNDGAFCYGCQSC 401 PPI+ ST GP+ S++P CSA + G G SC Sbjct: 1037 PPITPPSCPPTSTPPAGPSSSSQPPCSAAVSSGGSVPGAPSC 1078
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 30.8 bits (68), Expect = 3.5 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -2 Query: 526 PPISCGFTYQNSTQWTGPAKSTEPDCSAWSNDGAFCYGCQSC 401 PPI+ ST GP+ S++P CSA + G G SC Sbjct: 1037 PPITPPSCPPTSTPPAGPSSSSQPPCSAAVSSGGNVPGAPSC 1078
>CO1A2_HUMAN (P08123) Collagen alpha-2(I) chain precursor| Length = 1366 Score = 29.6 bits (65), Expect = 7.7 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 629 PPGRQGLQVPRGQEGDARPVHGLRSLPHP 543 PPG QG+Q +G++G A P G + LP P Sbjct: 533 PPGPQGVQGGKGEQGPAGP-PGFQGLPGP 560
>CO1A2_CANFA (O46392) Collagen alpha-2(I) chain precursor| Length = 1366 Score = 29.6 bits (65), Expect = 7.7 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 629 PPGRQGLQVPRGQEGDARPVHGLRSLPHP 543 PPG QG+Q +G++G A P G + LP P Sbjct: 533 PPGPQGVQGGKGEQGPAGP-PGFQGLPGP 560
>CO1A2_RAT (P02466) Collagen alpha-2(I) chain precursor| Length = 1372 Score = 29.6 bits (65), Expect = 7.7 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 629 PPGRQGLQVPRGQEGDARPVHGLRSLPHP 543 PPG QG+Q +G++G A P G + LP P Sbjct: 539 PPGPQGVQGGKGEQGPAGP-PGFQGLPGP 566
>CO1A2_MOUSE (Q01149) Collagen alpha-2(I) chain precursor| Length = 1372 Score = 29.6 bits (65), Expect = 7.7 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 629 PPGRQGLQVPRGQEGDARPVHGLRSLPHP 543 PPG QG+Q +G++G A P G + LP P Sbjct: 539 PPGPQGVQGGKGEQGPAGP-PGFQGLPGP 566
>CO1A2_BOVIN (P02465) Collagen alpha-2(I) chain precursor| Length = 1364 Score = 29.6 bits (65), Expect = 7.7 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 629 PPGRQGLQVPRGQEGDARPVHGLRSLPHP 543 PPG QG+Q +G++G A P G + LP P Sbjct: 531 PPGLQGVQGGKGEQGPAGP-PGFQGLPGP 558 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,812,983 Number of Sequences: 219361 Number of extensions: 1075423 Number of successful extensions: 3298 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3292 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)