ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd16a15 |
|---|---|
| Clone Library Name | barley_pub |
>LUXS_WOLSU (Q7MQP3) S-ribosylhomocysteine lyase (EC 4.4.1.21) (Autoinducer-2| production protein luxS) (AI-2 synthesis protein) Length = 163 Score = 30.4 bits (67), Expect = 3.3 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = -3 Query: 189 KHLHTQGWFFLGIHRTMRNXSGFXXLPCPALXCRTGLCQSLYSVXLYAEXVES 31 K +HT F G R N G + + CRTG SL V A +E+ Sbjct: 51 KGIHTLEHLFAGFMREHLNGEGIEIIDISPMGCRTGFYMSLIGVPKNARVLEA 103
>LACG_STAAW (P67769) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 30.0 bits (66), Expect = 4.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DP++PEDV A+ + I Sbjct: 215 VHALPTKYPFDPSNPEDVRAAELEDI 240
>LACG_STAAU (P11175) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 30.0 bits (66), Expect = 4.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DP++PEDV A+ + I Sbjct: 215 VHALPTKYPFDPSNPEDVRAAELEDI 240
>LACG_STAAS (Q6G7C5) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 30.0 bits (66), Expect = 4.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DP++PEDV A+ + I Sbjct: 215 VHALPTKYPFDPSNPEDVRAAELEDI 240
>LACG_STAAR (Q6GEP0) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 30.0 bits (66), Expect = 4.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DP++PEDV A+ + I Sbjct: 215 VHALPTKYPFDPSNPEDVRAAELEDI 240
>LACG_STAAN (P67768) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 30.0 bits (66), Expect = 4.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DP++PEDV A+ + I Sbjct: 215 VHALPTKYPFDPSNPEDVRAAELEDI 240
>LACG_STAAM (P67767) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 30.0 bits (66), Expect = 4.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DP++PEDV A+ + I Sbjct: 215 VHALPTKYPFDPSNPEDVRAAELEDI 240
>LACG_STAAC (Q5HE16) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 30.0 bits (66), Expect = 4.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DP++PEDV A+ + I Sbjct: 215 VHALPTKYPFDPSNPEDVRAAELEDI 240
>SCG1_PIG (Q9GLG4) Secretogranin-1 precursor (Secretogranin I) (SgI)| (Chromogranin B) (CgB) [Contains: Peptide SR-17; Peptide HQ-34; Peptide KR-11] Length = 668 Score = 29.6 bits (65), Expect = 5.6 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = -2 Query: 289 SQKGXHLQVXRRSXR*GGGHW*RERPDRLPEEGXAPSYSR 170 SQ+ L+V +R R H R RPDR P+EG P R Sbjct: 261 SQEDASLEVDKRRWRPRHHHG-RSRPDRAPQEGSPPPEER 299
>LACG_STAES (Q8CNF8) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 29.6 bits (65), Expect = 5.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DP++PEDV A+ + I Sbjct: 215 VHALPTKYPYDPSNPEDVRAAELEDI 240
>LACG_STAEQ (Q5HM41) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 29.6 bits (65), Expect = 5.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DP++PEDV A+ + I Sbjct: 215 VHALPTKYPYDPSNPEDVRAAELEDI 240
>LACG_STRMU (P50978) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 468 Score = 28.9 bits (63), Expect = 9.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 489 IRSLPTKLKIDPNDPEDVXTAKRKKI 412 + +LPTK DPN+P D+ A+ + I Sbjct: 215 VHALPTKYPYDPNNPADIRAAELEDI 240 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,542,978 Number of Sequences: 219361 Number of extensions: 986341 Number of successful extensions: 2085 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2047 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2084 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
