Clone Name | rbasd15e18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VTS1_KLULA (Q6CY29) Protein VTS1 | 31 | 3.2 | 2 | UL53_HCMVA (P16794) Protein UL53 (HFRF2 protein) | 30 | 7.2 | 3 | WASF4_HUMAN (Q8IV90) Wiskott-Aldrich syndrome protein family mem... | 29 | 9.4 |
---|
>VTS1_KLULA (Q6CY29) Protein VTS1| Length = 459 Score = 30.8 bits (68), Expect = 3.2 Identities = 16/66 (24%), Positives = 34/66 (51%), Gaps = 4/66 (6%) Frame = +3 Query: 45 NPQQTQIYKASSRRVMRLDSIQQLYHLKHKWQERPQNSTTKKRLPVNK*LI----PSQKS 212 N Q+Q+++A + + + LDS+ ++ +W PQN+ + + P+ L P Sbjct: 200 NKVQSQVHQAENPQPLNLDSVLNGDNIYRQWSPLPQNTASPMQQPMYDYLADIPRPRSAD 259 Query: 213 PCSSFR 230 P ++F+ Sbjct: 260 PYNAFK 265
>UL53_HCMVA (P16794) Protein UL53 (HFRF2 protein)| Length = 376 Score = 29.6 bits (65), Expect = 7.2 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +3 Query: 438 FHRAHFSYAAQVPARQAPPLLVGITGCGEAGTSTSRGHHRF--RHSWHPHSHAH 593 + A SYA + P +P +V GCG + +S S H + PH ++H Sbjct: 296 YEEATSSYAIRSPLTASPLHVVSTNGCGPSSSSQSTPPHLHPPSQATQPHHYSH 349
>WASF4_HUMAN (Q8IV90) Wiskott-Aldrich syndrome protein family member 4| (WASP-family protein member 4) Length = 625 Score = 29.3 bits (64), Expect = 9.4 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -3 Query: 605 PEPLMRMRVGVPAVPEPVMPTRSGGSSLAATCDAH 501 P P G PAVP P+ T SSL A DAH Sbjct: 530 PPPPFTGADGQPAVPPPLSDTTKPKSSLPAISDAH 564 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,000,828 Number of Sequences: 219361 Number of extensions: 1428904 Number of successful extensions: 4896 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4857 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)