Clone Name | rbasd15d23 |
---|---|
Clone Library Name | barley_pub |
>ALG14_CANAL (Q5A5N6) UDP-N-acetylglucosamine transferase subunit ALG14 (EC| 2.4.1.-) (Asparagine linked glycosylation protein 14) Length = 219 Score = 32.3 bits (72), Expect = 1.3 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = -3 Query: 295 RHRPALRLPSLGPGAVVPVGHLLLSVWPLIGLCSS 191 +HRPA+ L + GPG VPV ++L ++ L+GLC++ Sbjct: 138 KHRPAVILLN-GPGTCVPVAYILF-LYKLLGLCNT 170
>Y1068_METJA (Q58467) Hypothetical protein MJ1068| Length = 507 Score = 32.3 bits (72), Expect = 1.3 Identities = 18/84 (21%), Positives = 42/84 (50%), Gaps = 2/84 (2%) Frame = -1 Query: 411 LVGVFICLAIGCYLLQEHIRVSGGFREAFRKANGVSNT--IGIVLLFVYPVWVLVLWFL* 238 ++ + I +A+G Y L + F+ N S+T + I+ +F++ + + L+ + Sbjct: 129 VINILIIMAMGYYFLDSIVAFFSNILTGFQLQNYASSTRVVRILSVFIFSLIFIYLFNVH 188 Query: 237 DIYCYQCGH*LVCAVLFDVWGFIV 166 + Y + L+ V+ ++G+IV Sbjct: 189 NAYVPSVSYLLMAVVMIIIYGYIV 212
>DISC_DROME (P23792) Protein disconnected| Length = 568 Score = 32.0 bits (71), Expect = 1.7 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 16 MMFLLMVLYTRIKETKT*HQNYNKSKHVHQKVQARRVHRLRIPNHHRKGLH 168 M LL +Y R KT HQ YN + Q+ Q + H L + +HH++ H Sbjct: 483 MWSLLSEMY-RSMLLKTQHQQYNHHHQLQQQHQQEQHHHLTLSHHHQEQHH 532
>CL190_DROME (Q9VJE5) Restin homolog (Cytoplasmic linker protein 190)| (Microtubule-binding protein 190) (d-CLIP-190) Length = 1690 Score = 30.8 bits (68), Expect = 3.7 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 90 ETCPSEGTSAQSSSTPDTESPSKRSTR*IPKHRTELHK-PINGHTDSSRC 236 E CP +G+ Q STP +ES + R +P R + GH D+S C Sbjct: 1636 EDCPIQGSEDQDYSTPSSESNNNEKERKLPAPRKYCDSCEVFGH-DTSEC 1684
>SMC2_SCHPO (P41003) Structural maintenance of chromosome 2 (Chromosome| segregation protein cut14) (Cell untimely torn protein 14) Length = 1172 Score = 30.0 bits (66), Expect = 6.4 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 322 PEGLPEAS*HPDVLLKQVAPDGEAYEDADEVVPEVVREEAG 444 PE + + HP V LK V DG+ Y+ + + V + AG Sbjct: 634 PESAKKVTFHPSVKLKSVTLDGDVYDPSGTLTGGSVNKSAG 674
>CRED_ECOLI (P08369) Inner membrane protein creD| Length = 450 Score = 29.6 bits (65), Expect = 8.3 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = -3 Query: 355 QGVRRLQGGLQEGQWRIQHHRHRPALRLPSLGPGAVVPVGH----LLLSVWP 212 QG + + L EG WR Q+ + AL L G +VVP G L S WP Sbjct: 176 QGGQGVHIPLPEGDWRKQNLKLNMALNLSGTGDLSVVPGGRNSEMTLTSNWP 227
>TNNT2_MOUSE (P50752) Troponin T, cardiac muscle (TnTc) (Cardiac muscle troponin| T) (cTnT) Length = 300 Score = 29.6 bits (65), Expect = 8.3 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 6/62 (9%) Frame = +1 Query: 244 EPQHQDPDWVDEEQD------DADGVGYAIGLPEGLPEAS*HPDVLLKQVAPDGEAYEDA 405 E + ++ DW +EE+D + + G A PEG E + +++V PD EA +DA Sbjct: 11 EEEQEEEDWSEEEEDEQEEAVEEEEAGGAEPEPEGEAETE---EANVEEVGPDEEA-KDA 66 Query: 406 DE 411 +E Sbjct: 67 EE 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,348,087 Number of Sequences: 219361 Number of extensions: 2038804 Number of successful extensions: 6561 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6556 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)