Clone Name | rbasd15c14 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DHYS_METKA (Q8TXD7) Probable deoxyhypusine synthase (EC 2.5.1.46... | 30 | 5.5 | 2 | Y772_METJA (Q58182) Hypothetical protein MJ0772 | 30 | 9.4 | 3 | OPSG3_ASTFA (P51474) Green-sensitive opsin-3 (Green cone photore... | 30 | 9.4 |
---|
>DHYS_METKA (Q8TXD7) Probable deoxyhypusine synthase (EC 2.5.1.46) (DHS)| Length = 297 Score = 30.4 bits (67), Expect = 5.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 402 ADEAPMIEVPGVLDQIVGGFIWVLIQTH 485 ADE I PG+LD +VG +W+ Q H Sbjct: 162 ADEGVPIYSPGILDSMVGLHVWIHSQDH 189
>Y772_METJA (Q58182) Hypothetical protein MJ0772| Length = 353 Score = 29.6 bits (65), Expect = 9.4 Identities = 20/73 (27%), Positives = 31/73 (42%) Frame = -2 Query: 367 ECFPK*ISSRRLANMYFAYKHGKSFVKLLCHPLEVTALHIFVSVVNHNFRTVYFVDLHSK 188 E FP+ I + + YFA HG + + + + N N T+Y + HSK Sbjct: 179 EIFPEGILNTKATIRYFAKVHG--------YYISDRVAEYLLKITNGNLETIYLILRHSK 230 Query: 187 IWKQQLCVLVIPY 149 + L L IP+ Sbjct: 231 REIKNLRELKIPW 243
>OPSG3_ASTFA (P51474) Green-sensitive opsin-3 (Green cone photoreceptor pigment| 3) Length = 354 Score = 29.6 bits (65), Expect = 9.4 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 192 PKYGSSSYVFWLYHIHCFVSALVVYILVGQ 103 PKY + SYV +++ +H V V++ G+ Sbjct: 199 PKYNNESYVIYMFVVHFIVPVTVIFFTYGR 228 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,275,916 Number of Sequences: 219361 Number of extensions: 1835487 Number of successful extensions: 4121 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4120 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)