Clone Name | rbasd14m09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HOLB_BUCAI (P57435) DNA polymerase III delta' subunit (EC 2.7.7.7) | 29 | 6.2 | 2 | ZAN_PIG (Q28983) Zonadhesin precursor | 28 | 8.1 |
---|
>HOLB_BUCAI (P57435) DNA polymerase III delta' subunit (EC 2.7.7.7)| Length = 326 Score = 28.9 bits (63), Expect = 6.2 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +1 Query: 109 QKKRMLLAMHER*PLGVGISASIWFLMIPMHXXISLKMGTFCELHGCSRDSAES 270 QKK+ A+ + P G+G+S IWF+ + + + + + HGC SA + Sbjct: 19 QKKKAHHAILIKTPRGIGVSLLIWFISKWLLCLKPIGLNSCDKCHGCKLMSANN 72
>ZAN_PIG (Q28983) Zonadhesin precursor| Length = 2476 Score = 28.5 bits (62), Expect = 8.1 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Frame = -1 Query: 440 PAAAATNNISS--PRVLPNGSDSEAQFPSELISSCVATILMIQXCTEKQ--YHPAEVAHI 273 PA + N S P LP E Q ++S L CT ++ YHP + Sbjct: 1470 PATCLSLNNPSYCPSTLPCAEGCECQ-KGHILSGTSCVPLSQCGCTTQRGSYHPVGESWY 1528 Query: 272 LDSALSRLXPCSSQN 228 D++ SRL CS+ N Sbjct: 1529 TDNSCSRLCTCSAHN 1543 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,347,946 Number of Sequences: 219361 Number of extensions: 1133357 Number of successful extensions: 2764 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2764 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)