Clone Name | rbasd15b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NUP98_HUMAN (P52948) Nuclear pore complex protein Nup98-Nup96 pr... | 33 | 0.84 |
---|
>NUP98_HUMAN (P52948) Nuclear pore complex protein Nup98-Nup96 precursor| [Contains: Nuclear pore complex protein Nup98 (Nucleoporin Nup98) (98 kDa nucleoporin); Nuclear pore complex protein Nup96 (Nucleoporin Nup96) (96 kDa nucleoporin)] Length = 1729 Score = 32.7 bits (73), Expect = 0.84 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +2 Query: 311 CKFPRFPSISSVGSTSKWKLPRSSTPPVTLALQVPSVA 424 C+ PR S+ ++ STS W +P PP+T +PS A Sbjct: 1068 CRTPRAASLMNIPSTSSWSVP----PPLTSVFTMPSPA 1101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,670,999 Number of Sequences: 219361 Number of extensions: 1589103 Number of successful extensions: 4825 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4824 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)