| Clone Name | rbasd15b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase i... | 47 | 5e-05 | 2 | PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS) | 30 | 3.6 | 3 | IBB1_ARAHY (P01066) Bowman-Birk type proteinase inhibitor A-II [... | 30 | 4.7 | 4 | DTX3_HUMAN (Q8N9I9) Protein deltex-3 (Deltex-3) (Deltex3) | 30 | 6.1 |
|---|
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 46.6 bits (109), Expect = 5e-05 Identities = 26/61 (42%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = -1 Query: 405 KCCNNCR-SFSGVDVCDDAHPQCPKGCSACRV---VTPSPHKTFRCADMKSTVDGTCGGP 238 KCC NC SFSG+ CDD C C C V + S + FRC D T G CG Sbjct: 45 KCCTNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTD---TFLGMCGPK 101 Query: 237 C 235 C Sbjct: 102 C 102
>PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS)| Length = 5045 Score = 30.4 bits (67), Expect = 3.6 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +2 Query: 248 QVPSTVLFMSAQRNVL*GL--GVTTRQAEQPLGHWGWASSQTST 373 Q+P T +FMSA N L TT E P G+ W +Q+ T Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGT 1912
>IBB1_ARAHY (P01066) Bowman-Birk type proteinase inhibitor A-II [Contains:| Bowman-Birk type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III] Length = 70 Score = 30.0 bits (66), Expect = 4.7 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 402 CCNNCRSFSGVD-----VCDDAHPQCPKGCSACRVVTPSPHKTFRCAD 274 CCN C VC D CP C++C V T S RC D Sbjct: 11 CCNGCLCDRRAPPYFECVCVDTFDHCPASCNSC-VCTRSNPPQCRCTD 57
>DTX3_HUMAN (Q8N9I9) Protein deltex-3 (Deltex-3) (Deltex3)| Length = 347 Score = 29.6 bits (65), Expect = 6.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 192 VPPRIKLR*DEQSSCCYVCVWAVLYGQQYVRCLSSLC 82 +PPR++ +EQ S C +C+ + + +C S C Sbjct: 149 LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFC 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,685,211 Number of Sequences: 219361 Number of extensions: 1128983 Number of successful extensions: 3017 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3012 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)