| Clone Name | rbasd14k04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PNS1_GIBZE (Q4I8E9) Protein PNS1 | 35 | 0.28 | 2 | PURQ_STAES (Q8CPP0) Phosphoribosylformylglycinamidine synthase I... | 30 | 9.1 | 3 | PURQ_STAEQ (Q5HQA2) Phosphoribosylformylglycinamidine synthase I... | 30 | 9.1 | 4 | PNS1_NEUCR (Q870V7) Protein PNS1 | 30 | 9.1 |
|---|
>PNS1_GIBZE (Q4I8E9) Protein PNS1| Length = 538 Score = 34.7 bits (78), Expect = 0.28 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -3 Query: 135 LYKCLSCLRRAPDWAVSFKFDWLFIHLYLYGRA 37 ++ C+SCL +WAV F + F H+ LYG+A Sbjct: 378 IFCCISCLLGLLEWAVEFINRYAFCHIALYGKA 410
>PURQ_STAES (Q8CPP0) Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3)| (FGAM synthase I) Length = 223 Score = 29.6 bits (65), Expect = 9.1 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 101 GALLKHDKHLYSKRHHAVIVHNNGIIYEHL-VNNPN 205 GALL +D HL+ R+ + + NN + HL V N N Sbjct: 99 GALLHNDSHLFISRNETLKITNNQTPFTHLYVKNEN 134
>PURQ_STAEQ (Q5HQA2) Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3)| (FGAM synthase I) Length = 223 Score = 29.6 bits (65), Expect = 9.1 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 101 GALLKHDKHLYSKRHHAVIVHNNGIIYEHL-VNNPN 205 GALL +D HL+ R+ + + NN + HL V N N Sbjct: 99 GALLHNDSHLFISRNETLKITNNQTPFTHLYVKNEN 134
>PNS1_NEUCR (Q870V7) Protein PNS1| Length = 554 Score = 29.6 bits (65), Expect = 9.1 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 147 WCLLLYKCLSCLRRAPDWAVSFKFDWLFIHLYLYGRA 37 WC+ CL DW V F + F H+ LYG+A Sbjct: 396 WCIF-----GCLIGILDWLVEFINRYAFCHIALYGKA 427 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,621,596 Number of Sequences: 219361 Number of extensions: 2076047 Number of successful extensions: 4718 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4716 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)