Clone Name | rbasd14j07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EXTN3_ARATH (Q9FS16) Extensin-3 precursor (AtExt3) (AtExt5) | 33 | 0.51 | 2 | CI150_RAT (Q5BJW5) Protein C9orf150 homolog | 30 | 5.6 | 3 | CI150_MOUSE (Q8K2P1) Protein C9orf150 homolog | 30 | 5.6 | 4 | CP1A1_RABIT (P05176) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1)... | 30 | 7.3 | 5 | SPAG5_HUMAN (Q96R06) Sperm-associated antigen 5 (Astrin) (Mitoti... | 29 | 9.6 | 6 | NEU1_CATCO (P15210) Isoticin-neurophysin IT 1 precursor [Contain... | 29 | 9.6 |
---|
>EXTN3_ARATH (Q9FS16) Extensin-3 precursor (AtExt3) (AtExt5)| Length = 427 Score = 33.5 bits (75), Expect = 0.51 Identities = 26/94 (27%), Positives = 34/94 (36%) Frame = +3 Query: 159 PSTPSPRNPKTLISHKVPAESYKQHPPIPGRHRLWLRLGRYLIVFEPPTFVLD**KHPWQ 338 P SP PK +K P K + P P H Y+ PP P + Sbjct: 328 PVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP---------PVK 378 Query: 339 MLSQLFVFHKSKNFTSDYEIRMPPTVPINHYSDP 440 S V+H Y + PP P++HYS P Sbjct: 379 HYSPPPVYHSPPPPKEKYVYKSPPPPPVHHYSPP 412
>CI150_RAT (Q5BJW5) Protein C9orf150 homolog| Length = 221 Score = 30.0 bits (66), Expect = 5.6 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +1 Query: 127 SSSS*PFAGSYRRRHPPGTQRL*FLIRCRRSPISNIRRSLVGIV 258 SSSS P +GS RR HP +RL + R + N+R + V ++ Sbjct: 65 SSSSSPASGSPRRSHPSALERLETKLHILRQEMVNLRATDVRLM 108
>CI150_MOUSE (Q8K2P1) Protein C9orf150 homolog| Length = 221 Score = 30.0 bits (66), Expect = 5.6 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +1 Query: 127 SSSS*PFAGSYRRRHPPGTQRL*FLIRCRRSPISNIRRSLVGIV 258 SSSS P +GS RR HP +RL + R + N+R + V ++ Sbjct: 65 SSSSSPASGSPRRSHPSALERLETKLHILRQEMVNLRATDVRLM 108
>CP1A1_RABIT (P05176) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1) (P450 isozyme| 6) (P-450 PHPAH1) (P450 LM6) Length = 518 Score = 29.6 bits (65), Expect = 7.3 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +2 Query: 434 RSRRPTQ*DRNPMMLSHANVSRAMACFEHSNFFKVTMPKTRPGQLRLGARCRPKGR 601 R+RRP DR + A + M F H++F T+P + LG PKGR Sbjct: 357 RARRPRFSDRPQLPYLEAVI---METFRHTSFLPFTIPHSTTRDTSLGGFYIPKGR 409
>SPAG5_HUMAN (Q96R06) Sperm-associated antigen 5 (Astrin) (Mitotic| spindle-associated protein p126) (MAP126) (Deepest) Length = 1193 Score = 29.3 bits (64), Expect = 9.6 Identities = 25/102 (24%), Positives = 42/102 (41%), Gaps = 8/102 (7%) Frame = -1 Query: 288 RSDTVLVSTINDADQGSADVA------YRTPPAPYEKSKSLGSGGMASTVXXXXXXXXXR 127 R L S + DA G+ + + TP AP EKS + G+ T Sbjct: 360 RQSLSLPSMLRDAAIGTTPFSTCSVGTWFTPSAPQEKSTNTSQTGLVGTKHSTSETEQLL 419 Query: 126 AEKPPRKRNSHTHAFRKALSEIQNTLL--LVVLTVIAKKXQD 7 +PP H ++++ LL LV+L V++++ +D Sbjct: 420 CGRPPDLTALSRH-------DLEDNLLSSLVILEVLSRQLRD 454
>NEU1_CATCO (P15210) Isoticin-neurophysin IT 1 precursor [Contains: Isotocin| (IT); Neurophysin IT 1] Length = 154 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -3 Query: 343 SICQGCFH*SRTKVGGSKTIRYRPSLNHKRCRPGIGGCC 227 S+C C+ S +GG + I+ PS C PG G C Sbjct: 16 SVCSACYI-SNCPIGGKRAIQDSPSRQCMSCGPGDRGRC 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,427,434 Number of Sequences: 219361 Number of extensions: 1936058 Number of successful extensions: 4146 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4146 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)