Clone Name | rbasd14i17 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SCRK_KLEPN (P26420) Fructokinase (EC 2.7.1.4) | 29 | 9.0 |
---|
>SCRK_KLEPN (P26420) Fructokinase (EC 2.7.1.4)| Length = 307 Score = 28.9 bits (63), Expect = 9.0 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 216 LFRDPYFLGVCLIIALALGDGSSLSRRTASILSINDD 326 L++DP L CL ALAL D LS + +S +DD Sbjct: 163 LWQDPQDLRDCLDRALALADAIKLSEEELAFISGSDD 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,140,908 Number of Sequences: 219361 Number of extensions: 1211227 Number of successful extensions: 3322 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3322 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)