Clone Name | rbasd14d18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CP11A_PIG (P10612) Cytochrome P450 11A1, mitochondrial precursor... | 31 | 4.3 | 2 | MAK2_SCHPO (O14002) Peroxide stress-activated histidine kinase m... | 30 | 7.3 |
---|
>CP11A_PIG (P10612) Cytochrome P450 11A1, mitochondrial precursor (EC| 1.14.15.6) (CYPXIA1) (P450(scc)) (Cholesterol side-chain cleavage enzyme) (Cholesterol desmolase) Length = 520 Score = 30.8 bits (68), Expect = 4.3 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = -2 Query: 467 DGYTAVFRFDKERGILEIPANENLRFSHHIPSYRLTEEKGDTLRGFYELDPASVPDAFLV 288 +G+ ++RF KE+G +I + F + P YR EK L Y +DP V F Sbjct: 57 NGWINLYRFWKEKGTQKIHYHHVQNFQKYGPIYR---EKLGNLESVYIIDPEDVALLFKF 113 Query: 287 RG 282 G Sbjct: 114 EG 115
>MAK2_SCHPO (O14002) Peroxide stress-activated histidine kinase mak2 (EC| 2.7.13.3) (Mcs4-associated kinase 2) (His-Asp phosphorelay kinase phk1) Length = 2310 Score = 30.0 bits (66), Expect = 7.3 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +3 Query: 387 RKPQVLICRNLQNTPFFVKPEHSCVT----VYWSQKRELCAS 500 RKP+ L+ + ++ FV + S V +YW KRELC++ Sbjct: 1012 RKPEFLLRISQVDSDLFVIKDRSAVAHAELIYWGLKRELCST 1053 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,935,984 Number of Sequences: 219361 Number of extensions: 1935188 Number of successful extensions: 4537 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4535 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7252940416 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)