Clone Name | rbasd14d17 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LUXP_VIBHA (P54300) Autoinducer 2-binding periplasmic protein lu... | 30 | 8.9 | 2 | CCDC6_HUMAN (Q16204) Coiled-coil domain-containing protein 6 (H4... | 30 | 8.9 |
---|
>LUXP_VIBHA (P54300) Autoinducer 2-binding periplasmic protein luxP precursor| Length = 365 Score = 29.6 bits (65), Expect = 8.9 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +1 Query: 124 TSYSAAQIYILYARHPQIHFILCCSTAIATFAILWTANTVRTHISTSG 267 + Y AA+ + A+HP + FI CST +A A+ A R I +G Sbjct: 243 SGYDAAKASL--AKHPDVDFIYACSTDVALGAVDALAELGREDIMING 288
>CCDC6_HUMAN (Q16204) Coiled-coil domain-containing protein 6 (H4 protein)| (Papillary thyroid carcinoma-encoded protein) Length = 585 Score = 29.6 bits (65), Expect = 8.9 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 127 SYSAAQIYILYA-RHPQIHFILCCSTAIATFAILWTANTVRTHISTS 264 S+S Y L+A R ++H+ LCC +LW NT +T S S Sbjct: 499 SFSGIFGYDLFALRLSRLHYPLCCKCLSEMQPVLWVYNTNQTTFSIS 545 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,375,714 Number of Sequences: 219361 Number of extensions: 1817946 Number of successful extensions: 3809 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3809 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)