Clone Name | rbasd13o16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | POLG_HE71M (Q66479) Genome polyprotein [Contains: Coat protein V... | 30 | 3.0 |
---|
>POLG_HE71M (Q66479) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2192 Score = 29.6 bits (65), Expect = 3.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 122 RTYLQIHKYRAWAPAPLKLQHGLQRAKNVIAGN 220 R Y+++ RAW P P++ Q+ L +A AGN Sbjct: 814 RIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGN 846 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,719,703 Number of Sequences: 219361 Number of extensions: 812250 Number of successful extensions: 1388 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1388 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)