Clone Name | rbasd13m18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CYB_STRPU (P15547) Cytochrome b | 31 | 2.1 | 2 | PEBP2_MOUSE (Q8VIN1) Phosphatidylethanolamine-binding protein 2 ... | 31 | 2.1 | 3 | POLG_BOVEV (P12915) Genome polyprotein [Contains: Coat protein V... | 30 | 6.2 |
---|
>CYB_STRPU (P15547) Cytochrome b| Length = 380 Score = 31.2 bits (69), Expect = 2.1 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -1 Query: 209 SIITTW-WGAFSFGNSTACXLCKTYLGFMGVKAANVPSCHFFPFDXVYYFISAQILVINI 33 +II W WG FS N+T FFPF ++ FI A + VI++ Sbjct: 159 TIIVQWLWGGFSVDNATLT--------------------RFFPFHFLFPFIIAALAVIHL 198 Query: 32 XFSH 21 F H Sbjct: 199 VFLH 202
>PEBP2_MOUSE (Q8VIN1) Phosphatidylethanolamine-binding protein 2 (PEBP-2)| Length = 187 Score = 31.2 bits (69), Expect = 2.1 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +1 Query: 268 RKTIYRKWHYYLVIN*KINKYAS 336 +K +YR+WH++LV+N K N +S Sbjct: 77 KKPVYREWHHFLVVNMKGNDISS 99
>POLG_BOVEV (P12915) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2174 Score = 29.6 bits (65), Expect = 6.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -3 Query: 333 CIFIDLSIYYQIIMPLPVNRLSKLAQVRSILSTSGEE 223 CI D +I +P VN L ++AQV SIL + E Sbjct: 339 CILPDFQPTLEIFIPGKVNNLLEIAQVESILEANNRE 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,149,626 Number of Sequences: 219361 Number of extensions: 1349294 Number of successful extensions: 3427 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3424 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)