ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd14a04 |
|---|---|
| Clone Library Name | barley_pub |
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 45.8 bits (107), Expect = 1e-04 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 6/70 (8%) Frame = -2 Query: 643 ETLSSIKERLQKKLKVSEEDFSKWKFAYI---SLGRPDYFEDSDSVATRFQRNMYGAWE- 476 ETL +K+RLQK+L ++ FSK K A + S G+P Y D D V +YG E Sbjct: 1049 ETLKDLKKRLQKRLGYNDTQFSKVKLAVLQAQSFGKPYYLTDDDEV-------LYGELEP 1101 Query: 475 --QYLGLEHP 452 LGL+HP Sbjct: 1102 QSHILGLDHP 1111
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 43.1 bits (100), Expect = 7e-04 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 5/98 (5%) Frame = -2 Query: 655 IREDETLSSIKERLQKKLKVSEEDFSKWKFAYISLGRPDYF-EDSDSVATRFQRNMYGAW 479 I + E + +R+Q L + E++F K+KFA + GR Y ED V + G Sbjct: 1011 IHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMTGRHQYINEDEYEVNLKDFEPQPGNM 1070 Query: 478 EQ---YLGLEHPDTAPRKAHSANQNRHSF-ERPVKIYN 377 +LGL+H + AP++ +R+++ E+ +KI+N Sbjct: 1071 SHPRPWLGLDHFNKAPKR------SRYTYLEKAIKIHN 1102
>Y1379_METJA (Q58774) Hypothetical protein MJ1379| Length = 100 Score = 32.7 bits (73), Expect = 0.98 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = -2 Query: 643 ETLSSIKERLQKKLKVSEEDFSKWKFA-YISLGRPDYFEDSD-SVATRFQRNMYGAWEQY 470 +TLS IKE L+K K+ ++ + A + S R + E+SD + F N Y ++ +Y Sbjct: 2 KTLSEIKEILRKHKKILKDKYKVKSIALFGSYARGEQTEESDIDIMVEFDENNYPSFSEY 61 Query: 469 LGL 461 L L Sbjct: 62 LEL 64
>S19A1_CRIGR (P42557) Folate transporter 1 (Solute carrier family 19 member 1)| (Folate carrier protein) (Methotrexate uptake protein) Length = 518 Score = 32.7 bits (73), Expect = 0.98 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 12/105 (11%) Frame = +2 Query: 275 SYGTRFIQASNFSFSHLLGGIAWQDITPASHNCLVVDLY--RPLKRMAVLVSTMCLSWRC 448 S+ T ++ NF+ + I + P SH ++V ++ R ++ CLS+ C Sbjct: 46 SFITPYLLQQNFTIEQVTNEII--PVLPYSHLAVLVPIFLLTDYLRYKPILILQCLSFMC 103 Query: 449 VWVLQSKILLPSSIHVSLKSRSYTIR----------IFKIVWPAK 553 VW+L +L S +H+ L Y++ IF +V P++ Sbjct: 104 VWLL--LLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVRPSR 146
>K0317_MOUSE (Q8CHG5) Protein KIAA0317| Length = 823 Score = 32.0 bits (71), Expect = 1.7 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 5/75 (6%) Frame = +1 Query: 298 SQQFQFQPLAWWYCVAGYHSCFSQLSSCRSLQASQTNGGSG*HYVPFLALC-----LGAP 462 S F+ + + W++ V S +Q R LQ T G S F ALC + AP Sbjct: 725 SWHFREKVMRWFWAVV---SSLTQEELARLLQF--TTGSSQLPPGGFAALCPSFQIIAAP 779 Query: 463 VQDTAPKLHTCFSEI 507 T P HTCF+++ Sbjct: 780 THSTLPTAHTCFNQL 794
>K0317_HUMAN (O15033) Protein KIAA0317| Length = 823 Score = 31.6 bits (70), Expect = 2.2 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 5/75 (6%) Frame = +1 Query: 298 SQQFQFQPLAWWYCVAGYHSCFSQLSSCRSLQASQTNGGSG*HYVPFLALC-----LGAP 462 S F+ + + W++ V S +Q R LQ T G S F ALC + AP Sbjct: 725 SWHFREKVMRWFWTVV---SSLTQEELARLLQF--TTGSSQLPPGGFAALCPSFQIIAAP 779 Query: 463 VQDTAPKLHTCFSEI 507 T P HTCF+++ Sbjct: 780 THSTLPTAHTCFNQL 794
>HUL4_YEAST (P40985) Probable ubiquitin-protein ligase HUL4 (EC 6.3.2.-) (HECT| ubiquitin ligase 4) Length = 892 Score = 30.0 bits (66), Expect = 6.3 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 394 ASQTNGGSG*HYVPFLALCLGAPVQDTAPKLHTCFSEIS*LHYQN 528 AS +G +PF LG+ D P HTCF+EI +Y + Sbjct: 827 ASDRIPATGISTIPFKISLLGSHDSDDLPLAHTCFNEICLWNYSS 871
>S19A1_RAT (Q62866) Folate transporter 1 (Solute carrier family 19 member 1)| (Reduced folate carrier 1) (RFC1) (RFC-1) Length = 512 Score = 30.0 bits (66), Expect = 6.3 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 13/106 (12%) Frame = +2 Query: 275 SYGTRFIQASNFSFSHLLGGIAWQDITPASHNCLVVDLYRP---LKRMAVLVSTMCLSWR 445 S+ T ++ NF+ + I + P SH ++V ++ L+ VLV CLS+ Sbjct: 46 SFITPYLLERNFTKEQVTNEII--PMLPYSHLAVLVPIFLLTDYLRYKPVLV-LQCLSFV 102 Query: 446 CVWVLQSKILLPSSIHVSLKSRSYTIR----------IFKIVWPAK 553 CVW+L +L S +H+ L Y+I IF +V P++ Sbjct: 103 CVWLL--LLLGTSVVHMQLMEVFYSITMAARIAYSSYIFSLVQPSR 146
>YBY0_YEAST (P38272) Protein YBR130C| Length = 425 Score = 29.6 bits (65), Expect = 8.3 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -2 Query: 649 EDETLSSIKERLQKKLKVSEEDFSKWKFAY 560 E+E L+SI ER KKLK E+D+S+ Y Sbjct: 94 ENENLNSIFERKNKKLKELEKDYSELSNRY 123
>S15A1_CANFA (Q8WMX5) Oligopeptide transporter, small intestine isoform (Peptide| transporter 1) (Intestinal H(+)/peptide cotransporter) (Solute carrier family 15 member 1) Length = 708 Score = 29.6 bits (65), Expect = 8.3 Identities = 21/73 (28%), Positives = 33/73 (45%) Frame = +2 Query: 257 EQPVLPSYGTRFIQASNFSFSHLLGGIAWQDITPASHNCLVVDLYRPLKRMAVLVSTMCL 436 ++P G RFI + N S + +G + ++T SHN + + + ST + Sbjct: 479 QKPEKGENGIRFINSLNESLNITMGDKVYVNVT--SHNASEYQFFSLGTKNITISSTQQI 536 Query: 437 SWRCVWVLQSKIL 475 S C VLQS L Sbjct: 537 SQNCTKVLQSSNL 549 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,578,556 Number of Sequences: 219361 Number of extensions: 1841660 Number of successful extensions: 4713 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4713 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
