Clone Name | rbasd13i15 |
---|---|
Clone Library Name | barley_pub |
>DAX1_HUMAN (P51843) Nuclear receptor 0B1 (Nuclear receptor DAX-1) (DSS-AHC| critical region on the X chromosome protein 1) Length = 470 Score = 30.0 bits (66), Expect = 6.1 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = -1 Query: 554 HRDPTAPETPPAGVWSCR*RGTRWHVTPPPSSAEPPGDCTRMLFPLCF 411 H P APE P G W R + + P A P G T +L+ CF Sbjct: 157 HVAPAAPEARPGGAWWDR---SYFAQRPGGKEALPGGRATALLYRCCF 201
>CSKI1_MOUSE (Q6P9K8) Caskin-1 (CASK-interacting protein 1)| Length = 1431 Score = 29.6 bits (65), Expect = 8.0 Identities = 25/74 (33%), Positives = 31/74 (41%), Gaps = 12/74 (16%) Frame = -1 Query: 563 RPLHRDP-TAPETPPA------GVWSCR*RGTRWH-----VTPPPSSAEPPGDCTRMLFP 420 RP ++P T PE PP G + R R T + PPP AEPP L P Sbjct: 1153 RPKAKEPDTGPEPPPPLSVYQNGTATVRRRPTSEQAGPPELPPPPPPAEPPPADLMQLPP 1212 Query: 419 LCFATGRRRRHREP 378 L G R+ +P Sbjct: 1213 LPLPDGNARKPVKP 1226
>SMAD7_RAT (O88406) Mothers against decapentaplegic homolog 7 (SMAD 7)| (Mothers against DPP homolog 7) (Smad7) Length = 426 Score = 29.6 bits (65), Expect = 8.0 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 205 PQINHQASLSRLACSSTYGMSRHSNVPCPPYARSRV 98 P + H + + RL C +YG V C P+ SR+ Sbjct: 166 PDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRL 201
>SMAD7_MOUSE (O35253) Mothers against decapentaplegic homolog 7 (SMAD 7)| (Mothers against DPP homolog 7) (Smad7) (Madh8) Length = 426 Score = 29.6 bits (65), Expect = 8.0 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 205 PQINHQASLSRLACSSTYGMSRHSNVPCPPYARSRV 98 P + H + + RL C +YG V C P+ SR+ Sbjct: 166 PDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRL 201
>SMAD7_HUMAN (O15105) Mothers against decapentaplegic homolog 7 (SMAD 7)| (Mothers against DPP homolog 7) (Smad7) (hSMAD7) Length = 426 Score = 29.6 bits (65), Expect = 8.0 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 205 PQINHQASLSRLACSSTYGMSRHSNVPCPPYARSRV 98 P + H + + RL C +YG V C P+ SR+ Sbjct: 166 PDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRL 201 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,588,735 Number of Sequences: 219361 Number of extensions: 2011741 Number of successful extensions: 5344 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5338 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)