| Clone Name | rbasd13g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PEN2_ARATH (Q9FY84) Gamma-secretase subunit PEN2-like protein | 29 | 3.3 | 2 | ALG9_MOUSE (Q8VDI9) Alpha-1,2-mannosyltransferase ALG9 (EC 2.4.1... | 27 | 9.5 | 3 | ALG9_HUMAN (Q9H6U8) Alpha-1,2-mannosyltransferase ALG9 (EC 2.4.1... | 27 | 9.5 |
|---|
>PEN2_ARATH (Q9FY84) Gamma-secretase subunit PEN2-like protein| Length = 146 Score = 28.9 bits (63), Expect = 3.3 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 5/71 (7%) Frame = -2 Query: 259 VPWL---QCA*LW**RHQNQLFIGSEXKVVR*SGDAVGLYTLLSLISXWAWEWSIAXN-- 95 +PWL C W ++ F VVR A+G +L+S WA +SI Sbjct: 67 LPWLWFVNCFYFWPVLRHSRAFPQIRNYVVR---SAIGFSVFTALLSAWALTFSIGGEQL 123 Query: 94 FTPLYKIXHMY 62 F PLY MY Sbjct: 124 FGPLYDKLVMY 134
>ALG9_MOUSE (Q8VDI9) Alpha-1,2-mannosyltransferase ALG9 (EC 2.4.1.-)| (Asparagine-linked glycosylation protein 9 homolog) (Disrupted in bipolar disorder protein 1 homolog) Length = 611 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 238 MHIVAKAHWMKMEKNINLPSSLLHQYIPSELRGKL 342 +++ W + + LP + Q+IPSE RG+L Sbjct: 464 VNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQL 498
>ALG9_HUMAN (Q9H6U8) Alpha-1,2-mannosyltransferase ALG9 (EC 2.4.1.-)| (Asparagine-linked glycosylation protein 9 homolog) (Disrupted in bipolar disorder protein 1) Length = 611 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 238 MHIVAKAHWMKMEKNINLPSSLLHQYIPSELRGKL 342 +++ W + + LP + Q+IPSE RG+L Sbjct: 464 VNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQL 498 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,019,906 Number of Sequences: 219361 Number of extensions: 718795 Number of successful extensions: 1424 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1424 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)