Clone Name | rbasd13f23 |
---|---|
Clone Library Name | barley_pub |
>BPA1_MOUSE (Q91ZU6) Bullous pemphigoid antigen 1, isoforms 1/2/3/4 (BPA)| (Hemidesmosomal plaque protein) (Dystonia musculorum protein) (Dystonin) Length = 7389 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +3 Query: 123 RLTKETKSHMILIRDGGWLPMKEWLIR-DPHRCYHH 227 RL + +S +++ GGW+ + E+L++ DP R +HH Sbjct: 7138 RLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHH 7173
>YNQA_CAEEL (Q21986) Hypothetical protein R13F6.10 in chromosome III| Length = 958 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +3 Query: 9 CRRTTTDQKKLINCNQRIFPTSYNQHNVATTYNIYVLPRLTKE-TKSHMILIRDGGWLPM 185 C R + K++ +RI ++HN+ + Y ++ KE K M L +D G P Sbjct: 87 CYRDSNQHMKVVTLYERIIQVDPSEHNLTQLFMAYSREKMYKEQQKIGMRLYKDFGNAPY 146 Query: 186 KEWLI 200 W + Sbjct: 147 YFWSV 151
>HIS7_PICPA (Q92447) Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)| (IGPD) Length = 224 Score = 27.7 bits (60), Expect = 6.9 Identities = 20/65 (30%), Positives = 28/65 (43%) Frame = +3 Query: 114 VLPRLTKETKSHMILIRDGGWLPMKEWLIRDPHRCYHHHLLFFSSNCPCVFTLSGISDSE 293 ++ R+T ETK + L DGG + + + L +D H SS V T G D Sbjct: 10 LIKRITNETKIQIALSLDGGPVSLAQSLFKDKDYSAEHAAQATSSQFISVNTGIGFLDHM 69 Query: 294 DHRCA 308 H A Sbjct: 70 LHALA 74
>POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leader protein; Coat| protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3471 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 156 LIRDGGWLPMKEWLIRDPHRCYHHHLLFFSSNC 254 ++RDG + EW I P H LL F+ C Sbjct: 2060 ILRDGSGCYIDEWAIAGPRWLSFHELLPFTCGC 2092
>DOK6_HUMAN (Q6PKX4) Docking protein 6 (Downstream of tyrosine kinase 6)| Length = 331 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 78 NQHNVATTYNIYVLPRLTKETKSHMILI 161 N H V +NI + RL +ETK H + I Sbjct: 55 NFHKVTELHNIKNITRLPRETKKHAVAI 82
>POLG_RTSVA (Q83034) Genome polyprotein [Contains: Putative leader protein; Coat| protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3473 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 156 LIRDGGWLPMKEWLIRDPHRCYHHHLLFFSSNC 254 ++RDG + EW I P H LL F+ C Sbjct: 2063 ILRDGSGCYIDEWAIAGPRWLSFHELLPFTCGC 2095 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,116,279 Number of Sequences: 219361 Number of extensions: 836903 Number of successful extensions: 2001 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2001 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)