Clone Name | rbasd13f19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BIO5_YEAST (P53744) 7-keto 8-aminopelargonic acid transported (K... | 33 | 0.87 | 2 | LCMT2_NEUCR (Q9P3K9) Leucine carboxyl methyltransferase 2 (EC 2.... | 32 | 1.5 | 3 | YDT2_SCHPO (O14207) Hypothetical protein C6B12.02c in chromosome I | 32 | 1.9 |
---|
>BIO5_YEAST (P53744) 7-keto 8-aminopelargonic acid transported (KAPA| transporter) Length = 561 Score = 32.7 bits (73), Expect = 0.87 Identities = 20/92 (21%), Positives = 48/92 (52%), Gaps = 12/92 (13%) Frame = -3 Query: 412 LLCKQRLTNSTSYLFPSDSLVSDVYDLQTAFWKSWGV------------FMGVN*ATKIL 269 ++C +++T +P S + +D QT W S G+ F+G++ AT ++ Sbjct: 248 IICIVSRSDNTVDPWPKASNIFGSFDNQTG-WNSSGMAFVVGLVNPIWAFVGIDSATHMI 306 Query: 268 EDGKHPRTRMLK*KNLVSFVMYTFLISVLFCI 173 ++ + ++R L K +++ ++ F+ S ++C+ Sbjct: 307 DEVGYSKSRFLVPKVIITTIIVGFVTSFIYCV 338
>LCMT2_NEUCR (Q9P3K9) Leucine carboxyl methyltransferase 2 (EC 2.1.1.-)| Length = 1213 Score = 32.0 bits (71), Expect = 1.5 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = +3 Query: 42 QKKKNWTTLTRNGKGTTKGDTEHLSHR-PIKLQ**HQPIDDHKTIIQKRTEMRNVYITKE 218 QKK TT T GTT EH S + P K Q ++ +I+ KR+ + +Y E Sbjct: 34 QKKPKATTTTTTTDGTTPTHNEHASAKDPRKAQDDQVMGTNNSSIVSKRS-VEKLYYPNE 92 Query: 219 TRFFYFNIR 245 FF F ++ Sbjct: 93 PHFFRFFVK 101
>YDT2_SCHPO (O14207) Hypothetical protein C6B12.02c in chromosome I| Length = 1888 Score = 31.6 bits (70), Expect = 1.9 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = -3 Query: 499 HTHTLLLCTFWMAKEE---TDRKVPALKLIFGLLCKQRLTNSTSYLFPSDSLVSDVYDLQ 329 HTHTLL+C +W A E + ++ + ++ K RL + ++L ++ + D + Sbjct: 1097 HTHTLLICLYWAAPENCRPSLNRIRDIVIVDNSHLKARLISLKAWLHLMKYVIKEGTDYE 1156 Query: 328 TAFWKSW 308 A W Sbjct: 1157 LAQGMEW 1163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,502,916 Number of Sequences: 219361 Number of extensions: 1973466 Number of successful extensions: 4688 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4684 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)