Clone Name | rbasd13f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DSC2_BOVIN (P33545) Desmocollin-2 precursor (Epithelial type 2 d... | 28 | 6.3 | 2 | HLDD_NEIMB (Q9K002) ADP-L-glycero-D-manno-heptose-6-epimerase (E... | 28 | 8.2 | 3 | HLDD_NEIGO (Q51061) ADP-L-glycero-D-manno-heptose-6-epimerase (E... | 28 | 8.2 |
---|
>DSC2_BOVIN (P33545) Desmocollin-2 precursor (Epithelial type 2 desmocollin)| (Fragment) Length = 863 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 31 VQXIYARTHARYYVVSSPSVDKMNRNLLMI 120 +Q A+ + YY +S P VDK RNL + Sbjct: 113 IQSDTAQNYTIYYSISGPGVDKEPRNLFYV 142
>HLDD_NEIMB (Q9K002) ADP-L-glycero-D-manno-heptose-6-epimerase (EC 5.1.3.20)| (ADP-L-glycero-beta-D-manno-heptose-6-epimerase) (ADP-glyceromanno-heptose 6-epimerase) (ADP-hep 6-epimerase) (AGME) Length = 334 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 242 ETLMRDGLYTGINSYNFNFDTVEEKLPERIP 150 +T+ DGLY N+Y + D ++ ERIP Sbjct: 82 DTMNHDGLYMMDNNYQYTLDLLDWCQDERIP 112
>HLDD_NEIGO (Q51061) ADP-L-glycero-D-manno-heptose-6-epimerase (EC 5.1.3.20)| (ADP-L-glycero-beta-D-manno-heptose-6-epimerase) (ADP-glyceromanno-heptose 6-epimerase) (ADP-hep 6-epimerase) (AGME) Length = 334 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 242 ETLMRDGLYTGINSYNFNFDTVEEKLPERIP 150 +T+ DGLY N+Y + D ++ ERIP Sbjct: 82 DTMNHDGLYMMENNYQYTLDLLDWCQDERIP 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,552,221 Number of Sequences: 219361 Number of extensions: 344246 Number of successful extensions: 692 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 692 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)