Clone Name | rbasd13f07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y675_TREPA (O83681) Hypothetical protein TP0675 | 34 | 0.35 | 2 | SNTG1_HUMAN (Q9NSN8) Gamma-1-syntrophin (G1SYN) (Syntrophin 4) (... | 32 | 1.3 | 3 | SNTG1_MOUSE (Q925E1) Gamma-1-syntrophin (G1SYN) (Syntrophin 4) (... | 32 | 2.2 | 4 | MIRC_EMENI (Q870L3) Siderophore iron transporter mirC (Major fac... | 30 | 5.0 | 5 | LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late en... | 30 | 6.5 |
---|
>Y675_TREPA (O83681) Hypothetical protein TP0675| Length = 332 Score = 34.3 bits (77), Expect = 0.35 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 384 CSFRLKSSLPDGVPDSEGQFWQTLWPQWKLMLLPPLHAGPELLLHFAE 527 C+ + +LP + E FW+ PQ + +L + G E LLHF + Sbjct: 44 CTSLSRGALPSLISHKERMFWEIRGPQGSVYILGTISVGSEKLLHFQD 91
>SNTG1_HUMAN (Q9NSN8) Gamma-1-syntrophin (G1SYN) (Syntrophin 4) (SYN4)| Length = 517 Score = 32.3 bits (72), Expect = 1.3 Identities = 22/82 (26%), Positives = 37/82 (45%) Frame = -2 Query: 535 CGPSAKCRSSSGPACSGGSNISFH*GQSVCQNCPSESGTPSGRDDFNLKEQWQAQVLLIL 356 C PS + +S P C G ++++H + +C S +P R +++W L+ L Sbjct: 156 CAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLR----WEKRWCDLRLIPL 211 Query: 355 QQGMTSNPCPGMDANSRLSCFR 290 S PG D SR + F+ Sbjct: 212 LHSRFSQYVPGTDL-SRQNAFQ 232
>SNTG1_MOUSE (Q925E1) Gamma-1-syntrophin (G1SYN) (Syntrophin 4) (SYN4)| Length = 517 Score = 31.6 bits (70), Expect = 2.2 Identities = 19/73 (26%), Positives = 32/73 (43%) Frame = -2 Query: 535 CGPSAKCRSSSGPACSGGSNISFH*GQSVCQNCPSESGTPSGRDDFNLKEQWQAQVLLIL 356 C PS + +S P C G ++++H + +C S +P R +++W L+ L Sbjct: 156 CAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLR----WEKRWCDLRLIPL 211 Query: 355 QQGMTSNPCPGMD 317 S PG D Sbjct: 212 LHARFSQYVPGTD 224
>MIRC_EMENI (Q870L3) Siderophore iron transporter mirC (Major facilitator| iron-regulated transporter C) Length = 607 Score = 30.4 bits (67), Expect = 5.0 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +2 Query: 83 LNQQITNTLNFLYTIKVLYILPMLTLTLISYFYTSDRQQEYCTHSTAA 226 +N+ T+N L + +L LP++ L+L+ Y D+ E H A+ Sbjct: 546 INRSYQETMNKLLVLALLATLPLIPLSLLMSNYKLDKMSESSDHDDAS 593
>LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late envelope protein| 18) (Small proline-rich-like epidermal differentiation complex protein 5A) Length = 118 Score = 30.0 bits (66), Expect = 6.5 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 8/55 (14%) Frame = -2 Query: 547 CNTPCGP--SAKCRSSSGPACS---GGSNISFH*GQSVCQNCPSES---GTPSGR 407 C+ PC P S+ C SSSG CS GG +S H + + P S G+ SG+ Sbjct: 40 CSAPCPPPVSSCCGSSSGGCCSSEGGGCCLSHHRPRQSLRRRPQSSSCCGSGSGQ 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,533,407 Number of Sequences: 219361 Number of extensions: 1932734 Number of successful extensions: 5335 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5088 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5334 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)