ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd13f05 |
|---|---|
| Clone Library Name | barley_pub |
>RBL_PERSE (O04435) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 49.7 bits (117), Expect = 2e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -2 Query: 104 LFHSGPGYPCQXVIPVASGGIHVWHMPALTAIFG 3 ++ + P VIPVASGGIHVWHMPALT IFG Sbjct: 356 IYFTQPWVSLPGVIPVASGGIHVWHMPALTEIFG 389
>RBL_PLUAU (Q43036) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 49.7 bits (117), Expect = 2e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -2 Query: 104 LFHSGPGYPCQXVIPVASGGIHVWHMPALTAIFG 3 ++ + P VIPVASGGIHVWHMPALT IFG Sbjct: 362 IYFTQPWVSLPGVIPVASGGIHVWHMPALTEIFG 395
>RBL_BASAL (P25828) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 480 Score = 48.9 bits (115), Expect = 4e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -2 Query: 104 LFHSGPGYPCQXVIPVASGGIHVWHMPALTAIFG 3 ++ + P V+PVASGGIHVWHMPALT IFG Sbjct: 362 IYFTQPWVSTPGVLPVASGGIHVWHMPALTEIFG 395
>RBL_DRORE (P28411) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.9 bits (115), Expect = 4e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -2 Query: 104 LFHSGPGYPCQXVIPVASGGIHVWHMPALTAIFG 3 ++ + P V+PVASGGIHVWHMPALT IFG Sbjct: 353 IYFTQPWVSLPGVLPVASGGIHVWHMPALTEIFG 386
>RBL_DROFI (P28407) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.9 bits (115), Expect = 4e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -2 Query: 104 LFHSGPGYPCQXVIPVASGGIHVWHMPALTAIFG 3 ++ + P V+PVASGGIHVWHMPALT IFG Sbjct: 353 IYFTQPWVSLPGVLPVASGGIHVWHMPALTEIFG 386
>RBL_DROCA (P28405) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.9 bits (115), Expect = 4e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -2 Query: 104 LFHSGPGYPCQXVIPVASGGIHVWHMPALTAIFG 3 ++ + P V+PVASGGIHVWHMPALT IFG Sbjct: 353 IYFTQPWVSLPGVLPVASGGIHVWHMPALTEIFG 386
>RBL_RUTFR (P28449) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_PROLU (P28444) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_NELCA (P28433) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_JUSOD (P28428) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_HARGR (P28420) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_BULAR (O19989) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_BIXOR (O19872) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_BARPR (P28382) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_APHSI (P28379) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_WHEAT (P11383) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_ORYSA (P12089) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_ORYNI (Q6ENG6) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_LATCL (Q33584) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_HYOLA (Q9BA49) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_EXAAF (Q05989) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 446 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 340 VIPVASGGIHVWHMPALTEIFG 361
>RBL_DIGPU (P28399) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_AVESA (P48684) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_NEUTE (P19164) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 478 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_NEUMU (P19163) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 478 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_NYPFR (P28261) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_KIGAF (O98664) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 470 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_BERBR (Q31715) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 470 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_TECST (O98671) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_SALDI (P36485) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_PANJS (O98668) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_CATSP (Q33383) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_ACRAU (P43222) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 417 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 354 VIPVASGGIHVWHMPALTEIFG 375
>RBL_PODGR (P24680) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_PEA (P04717) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL1A_HYDMR (Q59458) Ribulose bisphosphate carboxylase large chain 1 (EC| 4.1.1.39) (RuBisCO large subunit 1) Length = 472 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPAL AIFG Sbjct: 366 VIPVASGGIHVWHMPALVAIFG 387
>RBL_ZAMZA (O98681) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_MONDI (Q33619) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 473 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_LIRPL (P93913) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 367 VIPVASGGIHVWHMPALTEIFG 388
>RBL_LAVLA (Q33600) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 473 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_ASPEL (P92445) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 367 VIPVASGGIHVWHMPALTEIFG 388
>RBL_AMOTI (Q8MD78) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 473 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 368 VIPVASGGIHVWHMPALTEIFG 389
>RBL_AJUCH (Q31655) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 473 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_BARSC (Q33162) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 456 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 367 VIPVASGGIHVWHMPALTEIFG 388
>RBL_SERRE (P25836) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_SCUBO (P28453) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_CALUS (P25829) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_SALPE (P31201) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 452 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_QUIIN (P28446) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_PASGU (P28438) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_HUMBA (P28424) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_BYRCR (P28387) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_BAURU (Q31730) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 364 VIPVASGGIHVWHMPALTEIFG 385
>RBL_AEGTA (P25414) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 421 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 319 VIPVASGGIHVWHMPALTEIFG 340
>RBL_AEGCR (P25413) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 421 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 319 VIPVASGGIHVWHMPALTEIFG 340
>RBL_BAMGL (P51994) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 440 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 363 VIPVASGGIHVWHMPALTEIFG 384
>RBL_ARTBA (P43225) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 416 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 353 VIPVASGGIHVWHMPALTEIFG 374
>RBL_ANACO (P48683) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 479 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_STRNX (P36489) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 471 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_DRYSU (P28259) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 471 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_ANTGA (P36478) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 471 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_ACAFA (P93998) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_DICCR (P31184) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 448 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 373 VIPVASGGIHVWHMPALTEIFG 394
>RBL_VERBO (P36490) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 340 VIPVASGGIHVWHMPALTEIFG 361
>RBL_SESIN (P36487) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 340 VIPVASGGIHVWHMPALTEIFG 361
>RBL_CALHE (Q05986) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 340 VIPVASGGIHVWHMPALTEIFG 361
>RBL_BUDDA (P36482) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 340 VIPVASGGIHVWHMPALTEIFG 361
>RBL_ANTMA (Q05554) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 340 VIPVASGGIHVWHMPALTEIFG 361
>RBL_CAMLE (Q95694) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 447 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_HORVU (P05698) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 426 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_SETIT (P56647) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 476 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_SACOF (Q6ENV5) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 476 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_SACHY (Q6L391) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 476 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_MAIZE (P00874) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 476 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 374 VIPVASGGIHVWHMPALTEIFG 395
>RBL_TABHE (Q37282) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 VIPVASGGIHVWHMPALT IFG Sbjct: 365 VIPVASGGIHVWHMPALTEIFG 386
>RBL_VITAE (P28460) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_TROMA (P48717) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_THEPO (P28457) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_SILGA (P25837) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_SAUCE (P36486) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_POLSI (Q9GHP8) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_PINCA (P28440) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_OXADI (P28436) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_NANDO (O20241) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_MOROL (P48708) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_ISOTA (P92463) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_EREMA (Q33443) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_DROPA (P28409) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_DROLU (P28408) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_DROBI (P28403) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_DRIWI (P28402) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_DIOMU (P28401) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_CUCPE (P48697) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_CORMY (P28394) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_CERJA (Q05987) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_CALPL (P28388) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_BETNI (P28384) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_BERLA (P36481) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_BEAGR (O99001) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_AVECA (Q9MTE7) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_ASACA (P36479) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_AESPA (Q31827) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_ADOMO (P28378) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_STEHA (P25838) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 482 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PHYAM (P25833) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 482 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_TOBAC (P00876) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_SOLTU (P25079) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_SANCA (P28450) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 436 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_PETHY (P04992) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PERAE (P30830) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PANGI (Q68RZ8) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 478 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_NICOT (P11422) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_NICDE (P48709) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_NICAC (P11421) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_LYCES (P27065) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_LACSA (P48706) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_GERJA (P51101) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CICIN (P48693) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CARTI (P48689) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_ATRBE (Q8RU60) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_ANEME (Q31674) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 420 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 354 VLPVASGGIHVWHMPALTEIFG 375
>RBL_VIOSO (Q05995) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 340 VLPVASGGIHVWHMPALTEIFG 361
>RBL_SYMAL (Q05993) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 340 VLPVASGGIHVWHMPALTEIFG 361
>RBL_POLRE (Q05992) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 340 VLPVASGGIHVWHMPALTEIFG 361
>RBL_NOTDE (Q32663) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_HELNU (P28422) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_GLYEC (O62970) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_FOUSP (Q05990) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 340 VLPVASGGIHVWHMPALTEIFG 361
>RBL_DROPT (P28410) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_DRODC (P28406) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_DARCA (P28398) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_BEGMS (P28383) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_PINVI (Q8WKC9) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 418 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 349 VLPVASGGIHVWHMPALTEIFG 370
>RBL_GLEJA (P48705) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 410 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 351 VLPVASGGIHVWHMPALTEIFG 372
>RBL_GLAGU (P93906) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 458 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 367 VLPVASGGIHVWHMPALTEIFG 388
>RBL_ARIGL (P93890) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 451 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_WATAN (P93936) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 444 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 367 VLPVASGGIHVWHMPALTEIFG 388
>RBL_STRLC (Q36800) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_SAXIN (P28452) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_RORGO (P28448) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_PRUDO (P28445) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_PARFI (P28437) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_NYSOG (P28435) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_MORAL (P28431) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_HEUMI (P28423) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_GEUCH (P28418) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_GAREL (P28416) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_CORLA (P31183) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CERGU (P28391) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_CEPFO (P28390) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_BOTST (P36477) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 444 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_APIGR (P28380) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_VITVI (P56648) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_VISAL (P48718) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_TSUHE (P26964) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_STEME (P46820) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_SPIOL (P00875) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_SPIMX (P48716) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_SOYBN (P27066) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_SOLGR (Q33101) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_QUERU (Q01874) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PSINU (P48714) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PSEMZ (P69571) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PSEKA (P24681) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_POPTM (P48713) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PINWA (P24676) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PINTH (P41621) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PINRA (P24679) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PINLO (P24677) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PINKO (Q7GUD0) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PINBA (P26962) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PICSI (P26961) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PICPU (P24674) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PICAB (P48711) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PHYPA (P34915) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_OSTVI (Q06025) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_ONYJA (Q36610) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 414 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 352 VLPVASGGIHVWHMPALTEIFG 373
>RBL_OENHO (Q9MTP9) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_NYMAL (Q6EW71) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_NOTSU (Q32701) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_NOLSP (Q32699) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_MAGTR (P61293) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_MAGMA (P30829) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_MAGAC (P30732) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_LOTJA (Q9BBU1) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_LIQST (Q01873) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_LAROX (P69570) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_KETDA (P26960) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_HUPLU (Q5SCV9) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_GOSHI (P14958) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_EQUAR (P48702) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_DATST (P48698) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_COUGU (O98883) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 367 VLPVASGGIHVWHMPALTEIFG 388
>RBL_CORCO (Q06024) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CORAT (Q31948) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 367 VLPVASGGIHVWHMPALTEIFG 388
>RBL_COLOB (P48695) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CLAXA (P28392) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CHAGL (Q8SN66) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CERGL (P25830) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CEDDE (P26959) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CASSA (P48690) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CARPA (P48688) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CARCO (Q06023) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CAPBA (Q31951) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_CALFE (Q7YJW4) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_BLEOR (P43226) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 414 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 351 VLPVASGGIHVWHMPALTEIFG 372
>RBL_BETPA (Q06022) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_BAZTR (P48685) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_ATRRS (P20455) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_ANTVS (Q31859) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_ANTHE (Q31669) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_AMBTC (Q70XZ5) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_AMATR (P48682) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_AMAHP (P16306) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_ALNIN (Q06021) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_ABIMA (P24671) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_SEDRU (P28455) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 450 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_CRAMA (P28395) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 450 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_VIGUN (O62964) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 473 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_VICCZ (Q05803) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_SINAL (P48715) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 473 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_SESSE (O62943) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 473 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_NYMOD (Q05802) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_NUPVA (Q05801) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_NELLU (Q05800) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_HELAN (P45738) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 485 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_FLAPR (P19162) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 485 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_FLABI (P19161) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 485 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_EURFE (Q05799) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_EUPAT (Q37192) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 485 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CERDE (Q05798) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_CAJCA (O63094) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 473 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_CABCA (Q05797) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_BRASC (Q05796) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_ALIPL (P34767) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_SALPL (P31202) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_HIPRI (P31189) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_TASIN (P28456) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_PHORE (P28262) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_PHECO (P31197) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 457 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 374 VLPVASGGIHVWHMPALTEIFG 395
>RBL_JASSU (P28427) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 365 VLPVASGGIHVWHMPALTEIFG 386
>RBL_CEDAT (Q9GGX6) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 366 VLPVASGGIHVWHMPALTEIFG 387
>RBL_ULMAL (Q33245) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_TROAR (P28458) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_SECDI (P28454) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_SARFL (P28451) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_RHOHI (P28447) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_PTEVI (Q33015) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 440 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_POLCR (P28443) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385
>RBL_PLAVR (P28442) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 47.8 bits (112), Expect = 9e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -2 Query: 68 VIPVASGGIHVWHMPALTAIFG 3 V+PVASGGIHVWHMPALT IFG Sbjct: 364 VLPVASGGIHVWHMPALTEIFG 385 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,760,852 Number of Sequences: 219361 Number of extensions: 188611 Number of successful extensions: 915 Number of sequences better than 10.0: 465 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 80,573,946 effective HSP length: 10 effective length of database: 78,380,336 effective search space used: 1881128064 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
