ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd13c11 |
|---|---|
| Clone Library Name | barley_pub |
>UBE2N_RAT (Q9EQX9) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 122 bits (305), Expect = 3e-28 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EEYPMA PKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD Sbjct: 60 EEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 119
>UBE2N_PONPY (Q5R7J6) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 122 bits (305), Expect = 3e-28 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EEYPMA PKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD Sbjct: 60 EEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 119
>UBE2N_MOUSE (P61089) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 122 bits (305), Expect = 3e-28 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EEYPMA PKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD Sbjct: 60 EEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 119
>UBE2N_HUMAN (P61088) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 122 bits (305), Expect = 3e-28 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EEYPMA PKVRF+TKIYHPN+DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD Sbjct: 60 EEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 119
>UBE2N_MACFA (Q4R4I1) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 119 bits (299), Expect = 2e-27 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EEYPMA PKVRF+TKIYHPN+DK GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD Sbjct: 60 EEYPMAAPKVRFMTKIYHPNVDKSGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 119
>UBCD3_DROME (P35128) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein bendless) Length = 151 Score = 118 bits (295), Expect = 5e-27 Identities = 53/60 (88%), Positives = 59/60 (98%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 E+YPM+ PKVRF+TKIYHPNID+LGRICLD+LKDKWSPALQIRT+LLSIQALLSAPNPDD Sbjct: 60 EDYPMSAPKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDD 119
>UBC13_SCHPO (O13685) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 148 Score = 109 bits (272), Expect = 2e-24 Identities = 50/60 (83%), Positives = 53/60 (88%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +EYPM PP VRFLTKIYHPN+DKLGRICL LK WSPALQIRTVLLSIQAL+ APNPDD Sbjct: 59 DEYPMMPPNVRFLTKIYHPNVDKLGRICLSTLKKDWSPALQIRTVLLSIQALMGAPNPDD 118
>UBC13_YEAST (P52490) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 153 Score = 108 bits (270), Expect = 4e-24 Identities = 49/60 (81%), Positives = 56/60 (93%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 ++YPM PKVRFLTKIYHPNID+LGRICLD+LK WSPALQIRTVLLSIQALL++PNP+D Sbjct: 60 DDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPND 119
>UBE2T_XENLA (Q7ZY08) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 192 Score = 90.5 bits (223), Expect = 1e-18 Identities = 44/64 (68%), Positives = 46/64 (71%), Gaps = 4/64 (6%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL----KDKWSPALQIRTVLLSIQALLSAP 15 E YP PPK+RFLT IYHPNID GRICLDIL K W PAL I TVL SIQ L+S P Sbjct: 59 ERYPFEPPKIRFLTPIYHPNIDSAGRICLDILKLPPKGAWRPALNISTVLTSIQLLMSEP 118 Query: 14 NPDD 3 NPDD Sbjct: 119 NPDD 122
>UBC4_SCHPO (P46595) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 88.2 bits (217), Expect = 5e-18 Identities = 40/59 (67%), Positives = 47/59 (79%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+D+WSPAL I VLLSI +LL+ PNPDD Sbjct: 59 DYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDD 117
>UBC1_MOUSE (P61087) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 87.8 bits (216), Expect = 7e-18 Identities = 41/61 (67%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E YP PPKVRF+TKI+HPNI + G ICLDILKD+W+ A+ +RTVLLS+QALL+A PD Sbjct: 63 ETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPD 122 Query: 5 D 3 D Sbjct: 123 D 123
>UBC1_HUMAN (P61086) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 87.8 bits (216), Expect = 7e-18 Identities = 41/61 (67%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E YP PPKVRF+TKI+HPNI + G ICLDILKD+W+ A+ +RTVLLS+QALL+A PD Sbjct: 63 ETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPD 122 Query: 5 D 3 D Sbjct: 123 D 123
>UBC1_BOVIN (P61085) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 87.8 bits (216), Expect = 7e-18 Identities = 41/61 (67%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E YP PPKVRF+TKI+HPNI + G ICLDILKD+W+ A+ +RTVLLS+QALL+A PD Sbjct: 63 ETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPD 122 Query: 5 D 3 D Sbjct: 123 D 123
>UBC11_ARATH (P35134) Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19)| (Ubiquitin-protein ligase 11) (Ubiquitin carrier protein 11) Length = 148 Score = 87.8 bits (216), Expect = 7e-18 Identities = 40/59 (67%), Positives = 47/59 (79%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F TK+YHPNI+ G ICLDILK++WSPAL I VLLSI +LL+ PNPDD Sbjct: 59 DYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117
>UBC1_MAGGR (Q9UVR2) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 147 Score = 87.4 bits (215), Expect = 9e-18 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+D+WSPAL I VLLSI ++L+ PNPDD Sbjct: 59 DYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDD 117
>UBE2T_HUMAN (Q9NPD8) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 197 Score = 87.4 bits (215), Expect = 9e-18 Identities = 41/64 (64%), Positives = 46/64 (71%), Gaps = 4/64 (6%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL----KDKWSPALQIRTVLLSIQALLSAP 15 E YP PP++RFLT IYHPNID GRICLD+L K W P+L I TVL SIQ L+S P Sbjct: 59 ERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEP 118 Query: 14 NPDD 3 NPDD Sbjct: 119 NPDD 122
>UBC5_YEAST (P15732) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 87.4 bits (215), Expect = 9e-18 Identities = 40/59 (67%), Positives = 46/59 (77%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F TKIYHPNI+ G ICLDILKD+WSPAL + VLLSI +LL+ NPDD Sbjct: 60 DYPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDD 118
>UB2D4_RAT (P70711) Ubiquitin-conjugating enzyme E2 D4 (EC 6.3.2.19)| (Ubiquitin-protein ligase D4) (Ubiquitin carrier protein D4) (Ubiquitin-conjugating enzyme E2-17 kDa 4) (E2(17)KB 4) Length = 147 Score = 87.0 bits (214), Expect = 1e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EYP PPKV F T+IYHPN++ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 EYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDD 117
>UBE2T_MOUSE (Q9CQ37) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 204 Score = 86.7 bits (213), Expect = 2e-17 Identities = 42/64 (65%), Positives = 46/64 (71%), Gaps = 4/64 (6%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL----KDKWSPALQIRTVLLSIQALLSAP 15 E YP PP+VRFLT IYHPNID GRICLDIL K W P+L I TVL SIQ L++ P Sbjct: 59 ERYPFEPPQVRFLTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEP 118 Query: 14 NPDD 3 NPDD Sbjct: 119 NPDD 122
>UBCD4_DROME (P52486) Ubiquitin-conjugating enzyme E2-22 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 199 Score = 86.3 bits (212), Expect = 2e-17 Identities = 40/61 (65%), Positives = 49/61 (80%), Gaps = 1/61 (1%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E YP PPKVRF+T+I+HPNI + G ICLDILKD W+ A+ +RTVLLS+QALL+A PD Sbjct: 64 ETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPD 123 Query: 5 D 3 D Sbjct: 124 D 124
>UBC9_ARATH (P35132) Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B) Length = 148 Score = 86.3 bits (212), Expect = 2e-17 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F TK++HPNI+ G ICLDILK++WSPAL I VLLSI +LL+ PNPDD Sbjct: 59 DYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117
>UBC8_ARATH (P35131) Ubiquitin-conjugating enzyme E2-17 kDa 8 (EC 6.3.2.19)| (Ubiquitin-protein ligase 8) (Ubiquitin carrier protein 8) (UBCAT4A) Length = 148 Score = 86.3 bits (212), Expect = 2e-17 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F TK++HPNI+ G ICLDILK++WSPAL I VLLSI +LL+ PNPDD Sbjct: 59 DYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117
>UBC4_LYCES (P35135) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 86.3 bits (212), Expect = 2e-17 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F TK++HPNI+ G ICLDILK++WSPAL I VLLSI +LL+ PNPDD Sbjct: 59 DYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117
>UBC10_ARATH (P35133) Ubiquitin-conjugating enzyme E2-17 kDa 10/12 (EC 6.3.2.19)| (Ubiquitin-protein ligase 10/12) (Ubiquitin carrier protein 10/12) Length = 148 Score = 86.3 bits (212), Expect = 2e-17 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F TK++HPNI+ G ICLDILK++WSPAL I VLLSI +LL+ PNPDD Sbjct: 59 DYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117
>UBC1_COLGL (O74196) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Colletotrichum hard-surface-induced protein 1) Length = 147 Score = 85.9 bits (211), Expect = 3e-17 Identities = 38/59 (64%), Positives = 47/59 (79%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+D+WSPAL I VLLSI ++L+ PNPD+ Sbjct: 59 DYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDE 117
>UBC4_YEAST (P15731) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 148 Score = 85.9 bits (211), Expect = 3e-17 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPK+ F TKIYHPNI+ G ICLDILKD+WSPAL + VLLSI +LL+ NPDD Sbjct: 60 DYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDD 118
>UBC4_CANAL (P43102) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 85.5 bits (210), Expect = 4e-17 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP+ PPK+ TKIYHPNI+ G ICLDILKD+WSPAL I VLLSI +LL+ NPDD Sbjct: 59 DYPLKPPKIALTTKIYHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDANPDD 117
>UB2D1_MOUSE (P61080) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 85.1 bits (209), Expect = 5e-17 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPK+ F TKIYHPNI+ G ICLDIL+ +WSPAL + VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDD 117
>UB2D1_HUMAN (P51668) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (UbcH5) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 85.1 bits (209), Expect = 5e-17 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPK+ F TKIYHPNI+ G ICLDIL+ +WSPAL + VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDD 117
>UBCD1_DROME (P25867) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) Length = 147 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD 117
>UBC2_CAEEL (P35129) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) (Lethal protein 70) Length = 147 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD 117
>UB2D3_RAT (P61078) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) (Phosphoarginine phosphatase) (PAPase) Length = 147 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD 117
>UB2D3_MOUSE (P61079) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD 117
>UB2D3_HUMAN (P61077) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD 117
>UB2D2_XENLA (P62840) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Xubc4) Length = 147 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD 117
>UB2D2_RAT (P62839) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD 117
>UB2D2_MOUSE (P62838) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD 117
>UB2D2_HUMAN (P62837) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYHPNI+ G ICLDIL+ +WSPAL I VLLSI +LL PNPDD Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD 117
>UBC1_YEAST (P21734) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 79.7 bits (195), Expect = 2e-15 Identities = 34/60 (56%), Positives = 47/60 (78%), Gaps = 1/60 (1%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EYP PPK++F TK+YHPNI + G ICLDILK+ WSP + +++ L+S+QALL +P P+D Sbjct: 61 EYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120
>UBE2C_MOUSE (Q9D1C1) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 79.7 bits (195), Expect = 2e-15 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 YP P V+FLT YHPN+D G ICLDILKDKWS +RT+LLSIQ+LL PN D Sbjct: 89 YPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNID 145
>UBC11_YEAST (P52492) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 156 Score = 78.2 bits (191), Expect = 6e-15 Identities = 31/57 (54%), Positives = 43/57 (75%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 + YP PP ++FL+ ++HPN+DK G ICLDILK+KWS + T+LLS+Q+LL PN Sbjct: 66 QNYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPN 122
>UBCD2_DROME (P52485) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 232 Score = 78.2 bits (191), Expect = 6e-15 Identities = 39/59 (66%), Positives = 43/59 (72%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EYP PPKV F T+IYH NI+ G ICLDILKD WSPAL I VLLSI +LL+ NP D Sbjct: 144 EYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 202
>UBE2C_HUMAN (O00762) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 78.2 bits (191), Expect = 6e-15 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 YP P V+FLT YHPN+D G ICLDILK+KWS +RT+LLSIQ+LL PN D Sbjct: 89 YPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNID 145
>UBCD6_DROME (P25153) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 78.2 bits (191), Expect = 6e-15 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 EEYP PP VRF++K++HPN+ G ICLDIL+++WSP + +L SIQ+LLS PNP+ Sbjct: 61 EEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPN 119
>UB2E1_MOUSE (P52482) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcM3) Length = 193 Score = 78.2 bits (191), Expect = 6e-15 Identities = 39/59 (66%), Positives = 43/59 (72%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EYP PPKV F T+IYH NI+ G ICLDILKD WSPAL I VLLSI +LL+ NP D Sbjct: 105 EYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 163
>UB2E1_HUMAN (P51965) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcH6) Length = 193 Score = 78.2 bits (191), Expect = 6e-15 Identities = 39/59 (66%), Positives = 43/59 (72%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 EYP PPKV F T+IYH NI+ G ICLDILKD WSPAL I VLLSI +LL+ NP D Sbjct: 105 EYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 163
>UBE2B_RAT (P63149) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 78.2 bits (191), Expect = 6e-15 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 EEYP PP VRFL+K++HPN+ G ICLDIL+++WSP + ++L SIQ+LL PNP+ Sbjct: 61 EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPN 119
>UBE2B_RABIT (P63148) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 78.2 bits (191), Expect = 6e-15 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 EEYP PP VRFL+K++HPN+ G ICLDIL+++WSP + ++L SIQ+LL PNP+ Sbjct: 61 EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPN 119
>UBE2B_MOUSE (P63147) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) Length = 152 Score = 78.2 bits (191), Expect = 6e-15 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 EEYP PP VRFL+K++HPN+ G ICLDIL+++WSP + ++L SIQ+LL PNP+ Sbjct: 61 EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPN 119
>UBE2B_HUMAN (P63146) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) Length = 152 Score = 78.2 bits (191), Expect = 6e-15 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 EEYP PP VRFL+K++HPN+ G ICLDIL+++WSP + ++L SIQ+LL PNP+ Sbjct: 61 EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPN 119
>UB2E3_MOUSE (P52483) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcM2) Length = 207 Score = 77.0 bits (188), Expect = 1e-14 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYH NI+ G ICLDILKD WSPAL I VLLSI +LL+ NP D Sbjct: 119 DYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 177
>UB2E3_HUMAN (Q969T4) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcH9) (UbcM2) Length = 207 Score = 77.0 bits (188), Expect = 1e-14 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYH NI+ G ICLDILKD WSPAL I VLLSI +LL+ NP D Sbjct: 119 DYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 177
>UBE2A_MOUSE (Q9Z255) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (mHR6A) Length = 152 Score = 77.0 bits (188), Expect = 1e-14 Identities = 32/59 (54%), Positives = 45/59 (76%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 EEYP PP VRF++K++HPN+ G ICLDIL+++WSP + ++L SIQ+LL PNP+ Sbjct: 61 EEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPN 119
>UBE2A_HUMAN (P49459) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (hHR6A) Length = 152 Score = 77.0 bits (188), Expect = 1e-14 Identities = 32/59 (54%), Positives = 45/59 (76%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 EEYP PP VRF++K++HPN+ G ICLDIL+++WSP + ++L SIQ+LL PNP+ Sbjct: 61 EEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPN 119
>UB2E2_MOUSE (Q91W82) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) Length = 201 Score = 77.0 bits (188), Expect = 1e-14 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYH NI+ G ICLDILKD WSPAL I VLLSI +LL+ NP D Sbjct: 113 DYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 171
>UB2E2_HUMAN (Q96LR5) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) (UbcH8) Length = 201 Score = 77.0 bits (188), Expect = 1e-14 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP PPKV F T+IYH NI+ G ICLDILKD WSPAL I VLLSI +LL+ NP D Sbjct: 113 DYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 171
>UBC1_CAEEL (P52478) Ubiquitin-conjugating enzyme E2 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 192 Score = 75.9 bits (185), Expect = 3e-14 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 EEYP PP V+F++K++HPN+ G ICLDIL+++WSP + +L SIQ+LL PNP+ Sbjct: 61 EEYPNKPPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPN 119
>UB2EC_XENLA (P56616) Ubiquitin-conjugating enzyme X (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UBC-X) Length = 179 Score = 75.1 bits (183), Expect = 5e-14 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 YP P V+F+T +HPN+D G ICLDILKDKWS +RT+LLS+Q+LL PN Sbjct: 89 YPYNAPTVKFVTPCFHPNVDSHGNICLDILKDKWSALYDVRTILLSLQSLLGEPN 143
>UBC21_CAEEL (P52484) Probable ubiquitin-conjugating enzyme E2 21 (EC 6.3.2.19)| (Ubiquitin-protein ligase 21) (Ubiquitin carrier protein 21) Length = 260 Score = 74.7 bits (182), Expect = 6e-14 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 16/76 (21%) Frame = -2 Query: 182 EEYPMAPPKV---------------RFLTKIYHPNID-KLGRICLDILKDKWSPALQIRT 51 E YP PPKV +F+T+I+HPNI + G ICLDILKDKW+ +L +RT Sbjct: 78 EHYPFEPPKVTEIIFHIRAFEYIQAKFVTRIWHPNISSQTGTICLDILKDKWTASLTLRT 137 Query: 50 VLLSIQALLSAPNPDD 3 VLLS+QA+L +P P D Sbjct: 138 VLLSLQAMLCSPEPSD 153
>UBC3_ARATH (P42746) Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 3) (Ubiquitin carrier protein 3) Length = 150 Score = 74.7 bits (182), Expect = 6e-14 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E+YP PP VRF+++++HPNI G ICLDIL+++WSP + VL SIQ+LL PNPD Sbjct: 61 EDYPNKPPIVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAVLTSIQSLLCDPNPD 119
>UB2EC_SPISO (Q95044) Ubiquitin-conjugating enzyme E2-C (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 177 Score = 74.7 bits (182), Expect = 6e-14 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 +YP PP V+F T +HPN+D+ G ICLDILK+ W+ + +RT+LLS+Q+LL PN Sbjct: 88 DYPYKPPVVKFTTPCWHPNVDQSGNICLDILKENWTASYDVRTILLSLQSLLGEPN 143
>UBC11_SCHPO (O00103) Ubiquitin-conjugating enzyme E2-20 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 176 Score = 73.9 bits (180), Expect = 1e-13 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 YP +PP + F + ++HPN+D G ICLDILKDKWS ++T+LLS+Q+LL PN Sbjct: 88 YPYSPPTIIFTSPMWHPNVDMSGNICLDILKDKWSAVYNVQTILLSLQSLLGEPN 142
>UBC2_USTMA (Q4PFA5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 185 Score = 73.9 bits (180), Expect = 1e-13 Identities = 30/59 (50%), Positives = 43/59 (72%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E YP PP V+FL+K++HPN+ G +CLDIL+++WSP + +L SIQ+LL PNP+ Sbjct: 61 ESYPNKPPTVKFLSKMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLHDPNPN 119
>UBC2_CRYNE (Q5KN22) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 169 Score = 73.2 bits (178), Expect = 2e-13 Identities = 29/58 (50%), Positives = 43/58 (74%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP 9 + YP PP VRF++K++HPNI G +CLDIL+++WSP + +L S+Q+LL+ PNP Sbjct: 61 DAYPNKPPTVRFISKMFHPNIYANGELCLDILQNRWSPTYDVAAILTSVQSLLNDPNP 118
>UBC2_WHEAT (P25866) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 73.2 bits (178), Expect = 2e-13 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E+YP PP VRF+++++HPNI G ICLDIL+++WSP + +L SIQ+LL PNP+ Sbjct: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPN 119
>UBC2_MEDSA (P35130) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 73.2 bits (178), Expect = 2e-13 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E+YP PP VRF+++++HPNI G ICLDIL+++WSP + +L SIQ+LL PNP+ Sbjct: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPN 119
>UBC2_ASHGO (Q75EB8) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 170 Score = 73.2 bits (178), Expect = 2e-13 Identities = 29/58 (50%), Positives = 44/58 (75%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP 9 EEYP PP V+FL++++HPN+ G ICLDIL+++W+P + ++L SIQ+L + PNP Sbjct: 61 EEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNP 118
>UBC2_ARATH (P42745) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) Length = 152 Score = 73.2 bits (178), Expect = 2e-13 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E+YP PP VRF+++++HPNI G ICLDIL+++WSP + +L SIQ+LL PNP+ Sbjct: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPN 119
>UBC1_ARATH (P25865) Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 152 Score = 73.2 bits (178), Expect = 2e-13 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 E+YP PP VRF+++++HPNI G ICLDIL+++WSP + +L SIQ+LL PNP+ Sbjct: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPN 119
>UBC2_KLULA (Q6CUD9) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 164 Score = 73.2 bits (178), Expect = 2e-13 Identities = 29/58 (50%), Positives = 44/58 (75%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP 9 EEYP PP V+FL++++HPN+ G ICLDIL+++W+P + ++L SIQ+L + PNP Sbjct: 61 EEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNP 118
>UBC2_YEAST (P06104) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 172 Score = 73.2 bits (178), Expect = 2e-13 Identities = 29/58 (50%), Positives = 44/58 (75%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP 9 EEYP PP V+FL++++HPN+ G ICLDIL+++W+P + ++L SIQ+L + PNP Sbjct: 61 EEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNP 118
>UBC2_CANGA (Q6FR76) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 167 Score = 72.0 bits (175), Expect = 4e-13 Identities = 28/58 (48%), Positives = 44/58 (75%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP 9 E+YP PP V+FL++++HPN+ G ICLDIL+++W+P + ++L SIQ+L + PNP Sbjct: 61 EDYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNP 118
>UBC12_YEAST (P52491) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 188 Score = 72.0 bits (175), Expect = 4e-13 Identities = 30/60 (50%), Positives = 43/60 (71%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 E YP+ PPKV L KI+HPNID G +CL+IL++ WSPAL +++++ + L PNP+D Sbjct: 88 EVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSPALDLQSIITGLLFLFLEPNPND 147
>UBC2_NECHA (P78717) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 151 Score = 72.0 bits (175), Expect = 4e-13 Identities = 28/57 (49%), Positives = 44/57 (77%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 E+YP PP+V+F+++++HPN+ G +CLDIL+++WSP + VL SIQ+LL+ PN Sbjct: 61 EQYPNKPPQVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPN 117
>UBC12_SCHPO (O74549) NEDD8-conjugating enzyme ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 177 Score = 71.6 bits (174), Expect = 5e-13 Identities = 29/60 (48%), Positives = 42/60 (70%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 + YP PPKV+ L KIYHPNID G +CL+IL+ W+P L + ++L+ +Q L +PN +D Sbjct: 78 DNYPHDPPKVKCLNKIYHPNIDIEGNVCLNILRQDWNPVLNLNSILVGLQFLFLSPNAED 137
>UBC2_NEUCR (P52493) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (Mutagen-sensitive protein 8) Length = 151 Score = 71.6 bits (174), Expect = 5e-13 Identities = 28/57 (49%), Positives = 43/57 (75%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 E+YP PP V+F+++++HPN+ G +CLDIL+++WSP + VL SIQ+LL+ PN Sbjct: 61 EQYPNKPPSVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPN 117
>UBC2_DEBHA (Q6BU36) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 168 Score = 71.2 bits (173), Expect = 7e-13 Identities = 27/57 (47%), Positives = 44/57 (77%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 E+YP PP V+F+++++HPN+ G +CLDIL+++WSP + ++L SIQ+LL+ PN Sbjct: 61 EQYPNKPPSVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSILTSIQSLLNDPN 117
>UBC2_CANAL (O74201) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 179 Score = 71.2 bits (173), Expect = 7e-13 Identities = 26/57 (45%), Positives = 45/57 (78%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 E+YP PP+V+F+++++HPN+ G +CLDIL+++WSP + ++L S+Q+LL+ PN Sbjct: 61 EQYPNKPPQVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSILTSVQSLLNDPN 117
>UBC2_TRIHA (Q58FS2) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 71.2 bits (173), Expect = 7e-13 Identities = 28/57 (49%), Positives = 44/57 (77%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 E+YP PP+V+F+++++HPN+ G +CLDIL+++WSP + VL SIQ+LL+ PN Sbjct: 61 EQYPNKPPQVKFISQMFHPNVYANGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPN 117
>UBC12_DROME (Q9VSF3) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-) (NEDD8 protein| ligase) (NEDD8 carrier protein) Length = 181 Score = 71.2 bits (173), Expect = 7e-13 Identities = 28/58 (48%), Positives = 41/58 (70%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 YP PPKV+ T++YHPNID G +CL+IL++ W+P L I +++ +Q L PNP+D Sbjct: 83 YPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPED 140
>UBC12_CANGA (Q6FVQ8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 187 Score = 70.1 bits (170), Expect = 2e-12 Identities = 30/60 (50%), Positives = 43/60 (71%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 E YP+ PPKV KI+HPNID G+ICL+IL++ WSPAL ++ ++L + +L PN +D Sbjct: 89 ETYPIDPPKVICNNKIFHPNIDPHGKICLNILREDWSPALDLQCIVLGLLSLFQEPNGND 148
>UBC2_YARLI (Q6C093) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 70.1 bits (170), Expect = 2e-12 Identities = 26/57 (45%), Positives = 43/57 (75%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 E+YP PP V+F+++++HPN+ G +CLDIL+++WSP + +L S+Q+LL+ PN Sbjct: 61 EQYPNKPPAVKFVSQMFHPNVYSSGELCLDILQNRWSPTYDVAAILTSVQSLLNDPN 117
>UBC2_EMENI (Q96UP5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (UV sensitivity protein J) Length = 151 Score = 70.1 bits (170), Expect = 2e-12 Identities = 27/57 (47%), Positives = 43/57 (75%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 E+YP PP V+F+++++HPN+ G +CLDIL+++WSP + +L SIQ+LL+ PN Sbjct: 61 EQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPN 117
>UBC2_ASPFU (Q4WLA7) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) Length = 151 Score = 70.1 bits (170), Expect = 2e-12 Identities = 27/57 (47%), Positives = 43/57 (75%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 E+YP PP V+F+++++HPN+ G +CLDIL+++WSP + +L SIQ+LL+ PN Sbjct: 61 EQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPN 117
>UBC12_XENTR (Q6P8D9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 69.3 bits (168), Expect = 3e-12 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 YP PPKV+ T +YHPNID G +CL+IL++ W P L I +++ +Q L PNP+D Sbjct: 86 YPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPED 143
>UBC12_XENLA (Q6DCZ9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 69.3 bits (168), Expect = 3e-12 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 YP PPKV+ T +YHPNID G +CL+IL++ W P L I +++ +Q L PNP+D Sbjct: 86 YPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPED 143
>UBC12_MOUSE (P61082) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 69.3 bits (168), Expect = 3e-12 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 YP PPKV+ T +YHPNID G +CL+IL++ W P L I +++ +Q L PNP+D Sbjct: 86 YPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPED 143
>UBC12_HUMAN (P61081) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 69.3 bits (168), Expect = 3e-12 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 YP PPKV+ T +YHPNID G +CL+IL++ W P L I +++ +Q L PNP+D Sbjct: 86 YPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPED 143
>UBE2S_MOUSE (Q921J4) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 223 Score = 68.6 bits (166), Expect = 4e-12 Identities = 30/59 (50%), Positives = 43/59 (72%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 +++P +PPK FLTKI+HPN+ G IC+++LK W+ L IR VLL+I+ LL PNP+ Sbjct: 68 KDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPE 126
>UBE2S_HUMAN (Q16763) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 222 Score = 68.6 bits (166), Expect = 4e-12 Identities = 30/59 (50%), Positives = 43/59 (72%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 6 +++P +PPK FLTKI+HPN+ G IC+++LK W+ L IR VLL+I+ LL PNP+ Sbjct: 68 KDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPE 126
>UBC2_SCHPO (P23566) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (RAD6 homolog) Length = 151 Score = 68.6 bits (166), Expect = 4e-12 Identities = 27/57 (47%), Positives = 42/57 (73%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 12 E+YP PP V+F++ ++HPN+ G +CLDIL+++WSP + +L SIQ+LL+ PN Sbjct: 61 EQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPN 117
>UBC12_ASHGO (Q75AF2) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 67.8 bits (164), Expect = 8e-12 Identities = 28/60 (46%), Positives = 40/60 (66%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 + YP+ PP V+ L IYHPNID G ICL++L++ WSP + ++TV+L + L PN D Sbjct: 85 DTYPIEPPTVKCLNTIYHPNIDYSGNICLNVLREDWSPVMDLQTVVLGLLFLFLEPNGSD 144
>UBC12_YARLI (Q6C9W0) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 179 Score = 67.8 bits (164), Expect = 8e-12 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 +P PPKV+ L K+YHPNID G +CL+IL++ W P L + V++ +Q L PN D Sbjct: 81 FPHEPPKVKCLQKVYHPNIDLEGNVCLNILREDWKPVLSLNAVMIGLQYLFLEPNASD 138
>UBC12_KLULA (Q6CSW8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 66.6 bits (161), Expect = 2e-11 Identities = 27/60 (45%), Positives = 42/60 (70%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 + YPM PP V+ + +IYHPNID G +CL++L++ W+PAL I+++++ I L PN D Sbjct: 85 DTYPMEPPVVKCMHRIYHPNIDIDGNVCLNLLREDWTPALDIQSIIIGILFLFHEPNGRD 144
>UBC12_ARATH (Q9SDY5) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme 1) (RUB1-protein ligase 1) (RUB1 carrier protein 1) Length = 184 Score = 66.6 bits (161), Expect = 2e-11 Identities = 28/58 (48%), Positives = 38/58 (65%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 YP PKV+ TK+YHPNID G +CL+IL++ W P L I TV+ + L + PN +D Sbjct: 88 YPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTVIYGLFHLFTEPNSED 145
>UBC_ASFB7 (P27949) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 66.2 bits (160), Expect = 2e-11 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 8/66 (12%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD--------KWSPALQIRTVLLSIQALL 24 EYP APPK+ F ++++HPNI GR+C+ IL WSPA +I T+LLS+ +LL Sbjct: 59 EYPYAPPKLTFTSEMWHPNIYPDGRLCISILHGDNAEEQGMTWSPAQKIDTILLSVISLL 118 Query: 23 SAPNPD 6 + PNPD Sbjct: 119 NEPNPD 124
>UB2L3_MOUSE (P68037) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcM4) Length = 154 Score = 66.2 bits (160), Expect = 2e-11 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILK-DKWSPALQIRTVLLSIQALLSAPNPD 6 EYP PPK+ F TKIYHPNID+ G++CL ++ + W PA + V+ S+ AL++ P P+ Sbjct: 60 EYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPE 118
>UB2L3_HUMAN (P68036) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcH7) (E2-F1) (L-UBC) Length = 154 Score = 66.2 bits (160), Expect = 2e-11 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILK-DKWSPALQIRTVLLSIQALLSAPNPD 6 EYP PPK+ F TKIYHPNID+ G++CL ++ + W PA + V+ S+ AL++ P P+ Sbjct: 60 EYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPE 118
>UB12L_ARATH (Q9ZU75) Probable NEDD8-conjugating enzyme Ubc12-like (EC 6.3.2.-)| (RUB1-conjugating enzyme 2) (RUB1-protein ligase 2) (RUB1 carrier protein 2) Length = 185 Score = 65.9 bits (159), Expect = 3e-11 Identities = 28/58 (48%), Positives = 38/58 (65%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 3 YP PKV+ TK+YHPNID G +CL+IL++ W P L I TV+ + L + PN +D Sbjct: 89 YPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTVIYGLFHLFTEPNYED 146
>UBC9_YEAST (P50623) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 157 Score = 64.3 bits (155), Expect = 8e-11 Identities = 28/60 (46%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD--KWSPALQIRTVLLSIQALLSAPNPD 6 EYP PPKV+F YHPN+ G ICL IL + W PA+ ++ ++L +Q LL +PNP+ Sbjct: 67 EYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPN 126
>UBC3_SCHPO (P40984) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase hus5) (Ubiquitin carrier protein hus5) (SUMO protein ligase) (SUMO-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 157 Score = 64.3 bits (155), Expect = 8e-11 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDK--WSPALQIRTVLLSIQALLSAPN 12 EEYP PPK RF ++HPN+ G +CL IL ++ W PA+ I+ +LL IQ LL PN Sbjct: 66 EEYPTRPPKCRFTPPLFHPNVYPSGTVCLSILNEEEGWKPAITIKQILLGIQDLLDDPN 124
>UBC84_DROME (P52487) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 153 Score = 63.5 bits (153), Expect = 1e-10 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILK-DKWSPALQIRTVLLSIQALLSAPNPD 6 +YP PPK+ F TKIYHPN+D+ G +CL I+ D W P + VL ++ A++ P P+ Sbjct: 60 QYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPE 118
>COP10_ARATH (Q9LJD7) Constitutive photomorphogenesis protein 10| Length = 182 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/57 (47%), Positives = 39/57 (68%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP 9 +YP PPK+ F T+IYH N+D G + ++IL+D WSPAL I VL +I+++ P P Sbjct: 94 DYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEP 150
>UB2G1_RAT (P62255) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 63.2 bits (152), Expect = 2e-10 Identities = 25/72 (34%), Positives = 47/72 (65%), Gaps = 13/72 (18%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLL 42 ++YP+ PPK++F+T+I+HPN+DK G +C+ IL +++W P + T+++ Sbjct: 62 KDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMI 121 Query: 41 SIQALLSAPNPD 6 S+ ++L+ PN D Sbjct: 122 SVISMLADPNGD 133
>UB2G1_MOUSE (P62254) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 63.2 bits (152), Expect = 2e-10 Identities = 25/72 (34%), Positives = 47/72 (65%), Gaps = 13/72 (18%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLL 42 ++YP+ PPK++F+T+I+HPN+DK G +C+ IL +++W P + T+++ Sbjct: 62 KDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMI 121 Query: 41 SIQALLSAPNPD 6 S+ ++L+ PN D Sbjct: 122 SVISMLADPNGD 133
>UB2G1_HUMAN (P62253) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 63.2 bits (152), Expect = 2e-10 Identities = 25/72 (34%), Positives = 47/72 (65%), Gaps = 13/72 (18%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLL 42 ++YP+ PPK++F+T+I+HPN+DK G +C+ IL +++W P + T+++ Sbjct: 62 KDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMI 121 Query: 41 SIQALLSAPNPD 6 S+ ++L+ PN D Sbjct: 122 SVISMLADPNGD 133
>UBC7_CAEEL (P34477) Probable ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 164 Score = 62.8 bits (151), Expect = 2e-10 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 13/69 (18%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD-------------KWSPALQIRTVLLS 39 +YP PPK++F+++I+HPNIDK G +C+ IL D +W P + T+LLS Sbjct: 62 DYPQKPPKMKFISEIWHPNIDKEGNVCISILHDPGDDKWGYERPEERWLPVHTVETILLS 121 Query: 38 IQALLSAPN 12 + ++L+ PN Sbjct: 122 VISMLTDPN 130
>UB2R1_MOUSE (Q8CFI2) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 235 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 13/69 (18%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLLS 39 +YP +PP RFLTK++HPNI + G +C+ IL ++W+P +RT+LLS Sbjct: 67 DYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLS 126 Query: 38 IQALLSAPN 12 + +LL+ PN Sbjct: 127 VISLLNEPN 135
>UB2R1_HUMAN (P49427) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 236 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 13/69 (18%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLLS 39 +YP +PP RFLTK++HPNI + G +C+ IL ++W+P +RT+LLS Sbjct: 67 DYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLS 126 Query: 38 IQALLSAPN 12 + +LL+ PN Sbjct: 127 VISLLNEPN 135
>UBE2I_XENLA (P63282) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/62 (43%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD--KWSPALQIRTVLLSIQALLSAPNP 9 ++YP +PPK +F ++HPN+ G +CL IL++ W PA+ I+ +LL IQ LL+ PN Sbjct: 66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNI 125 Query: 8 DD 3 D Sbjct: 126 QD 127
>UBE2I_RAT (P63281) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin-conjugating enzyme UbcE2A) Length = 158 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/62 (43%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD--KWSPALQIRTVLLSIQALLSAPNP 9 ++YP +PPK +F ++HPN+ G +CL IL++ W PA+ I+ +LL IQ LL+ PN Sbjct: 66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNI 125 Query: 8 DD 3 D Sbjct: 126 QD 127
>UBE2I_MOUSE (P63280) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (mUBC9) Length = 158 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/62 (43%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD--KWSPALQIRTVLLSIQALLSAPNP 9 ++YP +PPK +F ++HPN+ G +CL IL++ W PA+ I+ +LL IQ LL+ PN Sbjct: 66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNI 125 Query: 8 DD 3 D Sbjct: 126 QD 127
>UBE2I_HUMAN (P63279) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (p18) Length = 158 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/62 (43%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD--KWSPALQIRTVLLSIQALLSAPNP 9 ++YP +PPK +F ++HPN+ G +CL IL++ W PA+ I+ +LL IQ LL+ PN Sbjct: 66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNI 125 Query: 8 DD 3 D Sbjct: 126 QD 127
>UBE2I_CHICK (P63283) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/62 (43%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD--KWSPALQIRTVLLSIQALLSAPNP 9 ++YP +PPK +F ++HPN+ G +CL IL++ W PA+ I+ +LL IQ LL+ PN Sbjct: 66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNI 125 Query: 8 DD 3 D Sbjct: 126 QD 127
>UBC_MIMIV (Q5UQC9) Probable ubiquitin-conjugating enzyme E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 158 Score = 62.0 bits (149), Expect = 4e-10 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-KDKWSPALQIRTVLLSIQALLSAPNPDD 3 +YP + PKV+F+T I H N++ G ICL+IL KD W+ +L I +++ SI LL PNP+D Sbjct: 65 DYPYSSPKVKFITPIQHMNVNDKGDICLNILKKDGWNASLNIISIIWSIIVLLDQPNPED 124
>UB2R1_RABIT (Q29503) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 238 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 13/69 (18%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLLS 39 +YP +PP RFLTK++HPNI + G +C+ IL ++W+P +RT+LLS Sbjct: 67 DYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLS 126 Query: 38 IQALLSAPN 12 + +LL+ PN Sbjct: 127 VISLLNEPN 135
>UB2L6_HUMAN (O14933) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcH8) (Retinoic acid-induced gene B protein) (RIG-B) Length = 152 Score = 61.6 bits (148), Expect = 5e-10 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-KDKWSPALQIRTVLLSIQALLSAPN 12 EYP PP ++F TKIYHPN+D+ G+ICL I+ + W P + VL ++ L++ PN Sbjct: 59 EYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPN 115
>UBC_ASFM2 (P25869) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 213 Score = 61.2 bits (147), Expect = 7e-10 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 8/66 (12%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD--------KWSPALQIRTVLLSIQALL 24 +YP PP++ F ++++HPNI G++C+ IL WSPA +I TVLLS+ +LL Sbjct: 59 KYPYEPPRLTFTSEMWHPNIYSDGKLCISILHGDNAEEQGMTWSPAQKIDTVLLSVISLL 118 Query: 23 SAPNPD 6 + PNPD Sbjct: 119 NEPNPD 124
>UBC16_SCHPO (Q9P6I1) Ubiquitin-conjugating enzyme E2 16 (EC 6.3.2.19)| (Ubiquitin-protein ligase 16) (Ubiquitin carrier protein 16) Length = 160 Score = 60.1 bits (144), Expect = 2e-09 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLSIQALLS 21 E YP++PP V F TKI HPNI G +C+DILK WSPA +++ L+I +LLS Sbjct: 62 EGYPISPPSVYFQTKIVHPNISWTNGEVCMDILKTHWSPAWSLQSACLAIISLLS 116
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 60.1 bits (144), Expect = 2e-09 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLS-IQALLSAPNP 9 + YP P V F+TKIYHPN+D+L G +CLD++ WSP + V + + LL PNP Sbjct: 57 DAYPYKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNP 116 Query: 8 DD 3 D Sbjct: 117 SD 118
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 59.3 bits (142), Expect = 3e-09 Identities = 27/62 (43%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLS-IQALLSAPNP 9 + YP P V F+TKIYHPN+D++ G +CLD++ WSP + V + + LL PNP Sbjct: 57 DAYPYKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNP 116 Query: 8 DD 3 D Sbjct: 117 SD 118
>UB2G2_PONPY (Q5RF84) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 58.9 bits (141), Expect = 4e-09 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 13/71 (18%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLLS 39 +YP++PPK+RF +++HPNI GR+C+ IL ++WSP + +LLS Sbjct: 63 DYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLS 122 Query: 38 IQALLSAPNPD 6 + ++L+ PN + Sbjct: 123 VVSMLAEPNDE 133
>UB2G2_MOUSE (P60605) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 58.9 bits (141), Expect = 4e-09 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 13/71 (18%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLLS 39 +YP++PPK+RF +++HPNI GR+C+ IL ++WSP + +LLS Sbjct: 63 DYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLS 122 Query: 38 IQALLSAPNPD 6 + ++L+ PN + Sbjct: 123 VVSMLAEPNDE 133
>UB2G2_HUMAN (P60604) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 58.9 bits (141), Expect = 4e-09 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 13/71 (18%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLLS 39 +YP++PPK+RF +++HPNI GR+C+ IL ++WSP + +LLS Sbjct: 63 DYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLS 122 Query: 38 IQALLSAPNPD 6 + ++L+ PN + Sbjct: 123 VVSMLAEPNDE 133
>UBC15_SCHPO (Q9Y818) Ubiquitin-conjugating enzyme E2 15 (EC 6.3.2.19)| (Ubiquitin-protein ligase 15) (Ubiquitin carrier protein 15) Length = 167 Score = 57.8 bits (138), Expect = 8e-09 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 13/72 (18%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILK-------------DKWSPALQIRTVLL 42 ++YP+ PPK++F T+I+HPN+ G +C+ IL ++W P T+L+ Sbjct: 63 QDYPLMPPKMKFTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILI 122 Query: 41 SIQALLSAPNPD 6 S+ ++LS+PN + Sbjct: 123 SVISMLSSPNDE 134
>UBC3_YEAST (P14682) Ubiquitin-conjugating enzyme E2-34 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Cell division control protein 34) (E3 ubiquitin ligase complex SCF subunit CDC34) Length = 295 Score = 57.8 bits (138), Expect = 8e-09 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 12/69 (17%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL------------KDKWSPALQIRTVLLS 39 E++P +PP+ RF IYHPN+ + GR+C+ IL + WSP + +VL+S Sbjct: 68 EDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLIS 127 Query: 38 IQALLSAPN 12 I +LL PN Sbjct: 128 IVSLLEDPN 136
>UBC6_ARATH (P42750) Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 6) (Ubiquitin carrier protein 6) Length = 183 Score = 57.8 bits (138), Expect = 8e-09 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDK-LGRICLDILKDKWSPALQIRTVLLS-IQALLSAPNP 9 E YP P V F+ KIYHPN+D+ G +CLD++ WSP + V S + LL PNP Sbjct: 57 EAYPYKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNP 116 Query: 8 DD 3 D Sbjct: 117 SD 118
>UBC9_CAEEL (Q95017) Ubiquitin-conjugating enzyme E2 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) Length = 166 Score = 57.4 bits (137), Expect = 1e-08 Identities = 23/62 (37%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDK--WSPALQIRTVLLSIQALLSAPNP 9 +++P PPK +F ++HPN+ G +CL +L + W P++ I+ +L+ IQ LL+ PN Sbjct: 66 DDFPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDENKDWKPSISIKQLLIGIQDLLNHPNI 125 Query: 8 DD 3 +D Sbjct: 126 ED 127
>UBE2I_MESAU (O09181) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 57.4 bits (137), Expect = 1e-08 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKD--KWSPALQIRTVLLSIQALLSAPN 12 ++YP +PPK +F ++HPN+ G +CL IL++ W PA+ I + + IQ LL+ PN Sbjct: 66 DDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITINQLFIGIQELLNEPN 124
>UBC4_WHEAT (P16577) Ubiquitin-conjugating enzyme E2-23 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 184 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNP 9 E YP P + F KIYHPN+D++ G +CLD++ WSP + + + + LL PNP Sbjct: 57 EAYPYKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNP 116 Query: 8 DD 3 D Sbjct: 117 SD 118
>UBC7_YEAST (Q02159) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 165 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/70 (35%), Positives = 40/70 (57%), Gaps = 13/70 (18%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLL 42 ++YP++PPK+ F I HPNI G +C+ IL +++WSP + +LL Sbjct: 62 KDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILL 121 Query: 41 SIQALLSAPN 12 S+ ++LS PN Sbjct: 122 SVMSMLSEPN 131
>UBC13_ARATH (Q42541) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 166 Score = 56.6 bits (135), Expect = 2e-08 Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 13/72 (18%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLL 42 + YP +PP VRF + I+HPN+ GR+C+ IL ++W+P + +++L Sbjct: 62 QNYPNSPPTVRFTSDIWHPNVYPDGRVCISILHPPGDDPSGYELASERWTPVHTVESIML 121 Query: 41 SIQALLSAPNPD 6 SI ++LS PN + Sbjct: 122 SIISMLSGPNDE 133
>UB2L6_MOUSE (Q9QZU9) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcM8) Length = 152 Score = 56.6 bits (135), Expect = 2e-08 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-KDKWSPALQIRTVLLSIQALLSAPNPDD 3 EYP PP +RF TKIYHPN+ + G +CL ++ + W P + VL ++ L+S PN ++ Sbjct: 59 EYPFKPPTLRFTTKIYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEE 118
>UBC7_ARATH (Q42540) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 166 Score = 55.8 bits (133), Expect = 3e-08 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 13/72 (18%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLL 42 + YP +PP VRF + ++HPN+ GR+C+ IL ++W+P + +++L Sbjct: 62 QNYPNSPPTVRFTSDMWHPNVYSDGRVCISILHPPGDDPSGYELASERWTPVHTVESIML 121 Query: 41 SIQALLSAPNPD 6 SI ++LS PN + Sbjct: 122 SIISMLSGPNDE 133
>UBCY_ARATH (P42743) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme 15) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (PM42) Length = 161 Score = 55.5 bits (132), Expect = 4e-08 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKI-YHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSA 18 E YPM P+V F++ HP+I G ICLDIL D WSPA+ + +V +SI ++LS+ Sbjct: 71 EHYPMEAPQVVFVSPAPSHPHIYSNGHICLDILYDSWSPAMTVNSVCISILSMLSS 126
>UBC14_ARATH (P42747) Ubiquitin-conjugating enzyme E2 14 (EC 6.3.2.19)| (Ubiquitin-protein ligase 14) (Ubiquitin carrier protein 14) (TAYO29) Length = 167 Score = 55.1 bits (131), Expect = 5e-08 Identities = 23/72 (31%), Positives = 43/72 (59%), Gaps = 13/72 (18%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLL 42 E YP++PP V F ++++HPN+ G++C+ IL ++W+P + +++L Sbjct: 63 ENYPVSPPTVTFTSEMWHPNVYSDGKVCISILHPPGDDPHGYELASERWTPVHTVESIVL 122 Query: 41 SIQALLSAPNPD 6 SI ++LS PN + Sbjct: 123 SIISMLSGPNDE 134
>UBCX_PICAN (O60015) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 188 Score = 55.1 bits (131), Expect = 5e-08 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 23/79 (29%) Frame = -2 Query: 176 YPMAPPKVRFLT----------------------KIYHPNID-KLGRICLDILKDKWSPA 66 YP+ PPK++F+ K+ HPN++ K G ICLDIL+ KWSPA Sbjct: 71 YPLDPPKIKFVVFGEEKIRQLQRKTSSGARKVCYKMPHPNVNFKTGEICLDILQQKWSPA 130 Query: 65 LQIRTVLLSIQALLSAPNP 9 +++ L++I LL+ P P Sbjct: 131 WTLQSALVAIVVLLANPEP 149
>UBC7_WHEAT (P25868) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 168 Score = 54.7 bits (130), Expect = 7e-08 Identities = 22/71 (30%), Positives = 44/71 (61%), Gaps = 12/71 (16%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKLGRICL------------DILKDKWSPALQIRTVLLS 39 + YP +PP VRF ++++HPN+ GR+C+ ++ ++W+P + +++LS Sbjct: 65 QNYPNSPPTVRFTSEMWHPNVYPDGRVCISIHPPGDDPNGYELASERWTPVHTVESIVLS 124 Query: 38 IQALLSAPNPD 6 I ++LS+PN + Sbjct: 125 IISMLSSPNDE 135
>UBC7_SCHPO (O00102) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 166 Score = 54.7 bits (130), Expect = 7e-08 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 13/71 (18%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL-------------KDKWSPALQIRTVLLS 39 +YP+ PP ++F + +HPN+ K G +C+ IL ++WSP + +LLS Sbjct: 64 DYPLGPPTLKFECEFFHPNVYKDGTVCISILHAPGDDPNMYESSSERWSPVQSVEKILLS 123 Query: 38 IQALLSAPNPD 6 + ++L+ PN + Sbjct: 124 VMSMLAEPNDE 134
>UBE2H_MOUSE (P62257) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) Length = 183 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/62 (37%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLS-IQALLSAPNP 9 ++YP P + F+ KI+HPNID+ G +CLD++ W+ + + S + LL+ PNP Sbjct: 59 DKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNP 118 Query: 8 DD 3 D Sbjct: 119 ID 120
>UBE2H_HUMAN (P62256) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UbcH2) (E2-20K) Length = 183 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/62 (37%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNIDKL-GRICLDILKDKWSPALQIRTVLLS-IQALLSAPNP 9 ++YP P + F+ KI+HPNID+ G +CLD++ W+ + + S + LL+ PNP Sbjct: 59 DKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNP 118 Query: 8 DD 3 D Sbjct: 119 ID 120
>UBC8_YEAST (P28263) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Glucose-induced degradation protein 3) Length = 218 Score = 52.4 bits (124), Expect = 3e-07 Identities = 27/62 (43%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYHPNID-KLGRICLDILKDKWSPALQ-IRTVLLSIQALLSAPNP 9 + YP P + F+ KI+HPNID G ICLD++ WSP I V I LL PN Sbjct: 57 DNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNG 116 Query: 8 DD 3 D Sbjct: 117 SD 118
>UBE2U_HUMAN (Q5VVX9) Ubiquitin-conjugating enzyme E2 U (EC 6.3.2.19)| (Ubiquitin-protein ligase U) (Ubiquitin carrier protein U) Length = 321 Score = 50.1 bits (118), Expect = 2e-06 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 3/58 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNID-KLGRICLDIL--KDKWSPALQIRTVLLSIQALLSAP 15 EY APP V+F+T +HPN+D G+ C+D L +KW+ + ++LL++Q +LS P Sbjct: 62 EYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTNYTLSSILLALQVMLSNP 119
>UBE2U_MACFA (Q95LM1) Ubiquitin-conjugating enzyme E2 U (EC 6.3.2.19)| (Ubiquitin-protein ligase U) (Ubiquitin carrier protein U) Length = 322 Score = 49.3 bits (116), Expect = 3e-06 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 3/58 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNID-KLGRICLDILKD--KWSPALQIRTVLLSIQALLSAP 15 EY APP V+F+T +HPN+D G+ C+D L + KW+ + ++LL++Q +LS P Sbjct: 62 EYNYAPPVVKFVTIPFHPNVDPHTGQPCIDFLDNPKKWNTNYTLSSILLALQVMLSNP 119
>UBE2W_BRARE (Q4VBH4) Probable ubiquitin-conjugating enzyme E2 W (EC 6.3.2.19)| (Ubiquitin-protein ligase W) (Ubiquitin carrier protein W) Length = 151 Score = 48.1 bits (113), Expect = 6e-06 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = -2 Query: 176 YPMAPPKVRFLTKIY--HPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSA 18 YP P+V F + HP++ G ICL IL + WSPAL +++V LSI ++LS+ Sbjct: 64 YPFESPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSS 118
>UBE2W_MOUSE (Q8VDW4) Probable ubiquitin-conjugating enzyme E2 W (EC 6.3.2.19)| (Ubiquitin-protein ligase W) (Ubiquitin carrier protein W) Length = 151 Score = 47.8 bits (112), Expect = 8e-06 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = -2 Query: 176 YPMAPPKVRFLTKIY--HPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSA 18 YP P+V F + HP++ G ICL IL + WSPAL +++V LSI ++LS+ Sbjct: 64 YPFDSPQVMFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSS 118
>UBE2W_HUMAN (Q96B02) Probable ubiquitin-conjugating enzyme E2 W (EC 6.3.2.19)| (Ubiquitin-protein ligase W) (Ubiquitin carrier protein W) Length = 151 Score = 47.8 bits (112), Expect = 8e-06 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = -2 Query: 176 YPMAPPKVRFLTKIY--HPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSA 18 YP P+V F + HP++ G ICL IL + WSPAL +++V LSI ++LS+ Sbjct: 64 YPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSS 118
>UBC12_CAEEL (Q9XVK5) NEDD8-conjugating enzyme ubc-12 (EC 6.3.2.-) (NEDD8| protein ligase) (NEDD8 carrier protein) (Ubiquitin-conjugating enzyme E2 12) Length = 180 Score = 44.7 bits (104), Expect = 7e-05 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 6/59 (10%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDK------WSPALQIRTVLLSIQALLS 21 EY PP V+ LTK++HPNI++ G ICL IL+ W P + V+ + +L + Sbjct: 86 EYNNVPPVVKCLTKVWHPNINEDGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFN 144
>UBC17_CAEEL (Q11076) Probable ubiquitin-conjugating enzyme protein 17| Length = 679 Score = 43.9 bits (102), Expect = 1e-04 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 12/63 (19%) Frame = -2 Query: 176 YPMAPPKVRFLTK-----IYHPNIDKLGRICLDIL-------KDKWSPALQIRTVLLSIQ 33 YP +PPK FLT ++PN+ G+ICL IL ++KW+P + VL+SIQ Sbjct: 472 YPFSPPKCAFLTTGSGNVRFNPNLYNDGKICLSILGTWEGRPEEKWNPYCSLMQVLVSIQ 531 Query: 32 ALL 24 ++ Sbjct: 532 EVI 534
>UBCX_PICPA (P49428) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 204 Score = 43.5 bits (101), Expect = 2e-04 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = -2 Query: 155 VRFLTKIYHPNID-KLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNP 9 +R ++ HPNI G ICLDIL+ KW+PA + + L +I LL+ P P Sbjct: 114 LRHCYRMPHPNIAFNTGEICLDILQAKWTPAWTLSSALTAIVLLLNDPEP 163
>UBCX_YEAST (P29340) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 183 Score = 39.7 bits (91), Expect = 0.002 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = -2 Query: 176 YPMAPPKVRFL-TKIYHPNI-DKLGRICLDILK-DKWSPALQIRTVLLSIQALLSAP 15 YPM PPK+ F+ I H N+ G ICL+ILK ++W+P + + ++ LL P Sbjct: 88 YPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREP 144
>BIRC6_HUMAN (Q9NR09) Baculoviral IAP repeat-containing protein 6| (Ubiquitin-conjugating BIR-domain enzyme apollon) Length = 4829 Score = 37.0 bits (84), Expect = 0.014 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 13/71 (18%) Frame = -2 Query: 182 EEYPMAPPKVRFLTKIYH-----PNIDKLGRICLDIL-------KDKWSP-ALQIRTVLL 42 ++YP +PP V T H PN+ G++CL IL ++KW+P VL+ Sbjct: 4606 QDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQVLV 4665 Query: 41 SIQALLSAPNP 9 S+Q+L+ P Sbjct: 4666 SVQSLILVAEP 4676
>UB2J1_MOUSE (Q9JJZ4) Ubiquitin-conjugating enzyme E2 J1 (EC 6.3.2.19)| (Non-canonical ubiquitin-conjugating enzyme 1) (NCUBE1) Length = 318 Score = 35.4 bits (80), Expect = 0.042 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL---KDKWSPALQIRTVLLSI 36 EYPM PP + LT + K +ICL I + W P+ IRT LL+I Sbjct: 67 EYPMKPPSIILLTANGRFEVGK--KICLSISGHHPETWQPSWSIRTALLAI 115
>UB2J1_HUMAN (Q9Y385) Ubiquitin-conjugating enzyme E2 J1 (EC 6.3.2.19)| (Non-canonical ubiquitin-conjugating enzyme 1) (NCUBE1) (Yeast ubiquitin-conjugating enzyme UBC6 homolog E) (HSUBC6e) Length = 318 Score = 35.4 bits (80), Expect = 0.042 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDIL---KDKWSPALQIRTVLLSI 36 EYPM PP + LT + K +ICL I + W P+ IRT LL+I Sbjct: 67 EYPMKPPSIILLTANGRFEVGK--KICLSISGHHPETWQPSWSIRTALLAI 115
>MMS2_YEAST (P53152) Ubiquitin-conjugating enzyme variant MMS2 (UEV MMS2)| Length = 137 Score = 33.1 bits (74), Expect = 0.21 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNID-KLGRICLDI--LKDKWSPALQIRTVLLSIQALLSAP 15 YP +PPKV F++KI P ++ G + D L+D W A + T+LL ++ ++ P Sbjct: 68 YPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRD-WKRAYTMETLLLDLRKEMATP 123
>UBC6_ASHGO (Q74Z34) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC6) (Ubiquitin carrier protein UBC6) Length = 242 Score = 31.6 bits (70), Expect = 0.61 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICL---DILKDKWSPALQIRTVLLSIQALLS 21 +YP PP +R LT + + R+CL D D W+P+ + T+L + + ++ Sbjct: 63 DYPFNPPAIRMLTP--NGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMT 116
>UB2V2_RAT (Q7M767) Ubiquitin-conjugating enzyme E2 variant 2| (Ubiquitin-conjugating enzyme variant MMS2) Length = 144 Score = 31.6 bits (70), Expect = 0.61 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRI----CLDILKDKWSPALQIRTVLLSIQALL 24 +YP APP VRF+TKI I+ + + +L KW + I+ VL ++ L+ Sbjct: 71 KYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLA-KWQNSYSIKVVLQELRRLM 125
>UB2V2_HUMAN (Q15819) Ubiquitin-conjugating enzyme E2 variant 2 (MMS2)| (Enterocyte differentiation-associated factor EDAF-1) (Enterocyte differentiation-promoting factor) (EDPF-1) (Vitamin D3-inducible protein) (DDVit 1) Length = 144 Score = 31.6 bits (70), Expect = 0.61 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRI----CLDILKDKWSPALQIRTVLLSIQALL 24 +YP APP VRF+TKI I+ + + +L KW + I+ VL ++ L+ Sbjct: 71 KYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLA-KWQNSYSIKVVLQELRRLM 125
>UB2V1_HUMAN (Q13404) Ubiquitin-conjugating enzyme E2 variant 1 (UEV-1) (CROC-1)| (Ubiquitin-conjugating enzyme variant Kua) (TRAF6-regulated IKK activator 1 beta Uev1A) Length = 221 Score = 31.6 bits (70), Expect = 0.61 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRI----CLDILKDKWSPALQIRTVLLSIQALL 24 +YP APP VRF+TKI ++ + + +L KW + I+ VL ++ L+ Sbjct: 148 KYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLA-KWQNSYSIKVVLQELRRLM 202
>UB2V2_MOUSE (Q9D2M8) Ubiquitin-conjugating enzyme E2 variant 2 (Ubc-like| protein MMS2) Length = 144 Score = 31.2 bits (69), Expect = 0.79 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRI----CLDILKDKWSPALQIRTVLLSIQALL 24 +YP APP VRF+TKI I+ + + +L KW + I+ +L ++ L+ Sbjct: 71 KYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLA-KWQNSYSIKVILQELRRLM 125
>UBC6_YEAST (P33296) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC6) (Ubiquitin carrier protein UBC6) Length = 250 Score = 31.2 bits (69), Expect = 0.79 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -2 Query: 179 EYPMAPPKVRFLTK--IYHPNIDKLGRICL---DILKDKWSPALQIRTVLLSIQALLSA 18 +YP PP +R +T + PN R+CL D D W+P + T+L + + +++ Sbjct: 63 DYPYKPPAIRMITPNGRFKPNT----RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTS 117
>UBC6_DEBHA (Q6BYG4) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC6) (Ubiquitin carrier protein UBC6) Length = 242 Score = 30.0 bits (66), Expect = 1.8 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICL---DILKDKWSPALQIRTVLLSIQALLS 21 EYP PP + +T + R+CL D D W+PA + T+L + + ++ Sbjct: 63 EYPFKPPSISMITP--NGRFACNTRLCLSMSDYHPDTWNPAWSVATILTGLLSFMT 116
>UBC6_CANGA (Q6FQK7) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC6) (Ubiquitin carrier protein UBC6) Length = 246 Score = 30.0 bits (66), Expect = 1.8 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICL---DILKDKWSPALQIRTVLLSIQALLS 21 +YP PP +R +T + + R+CL D D W+P + T+L + + ++ Sbjct: 63 DYPYKPPAIRMITP--NGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMT 116
>UBC6_SCHPO (O42646) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc6) (Ubiquitin carrier protein ubc6) Length = 227 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICL---DILKDKWSPALQIRTVLLSIQALLSA 18 +YP PP +R +T R+CL D W+P+ + T+L+ + + +++ Sbjct: 63 DYPFKPPAIRMITP--SGRFQTNTRLCLSFSDFHPKSWNPSWMVSTILVGLVSFMTS 117
>UB2J2_MOUSE (Q6P073) Ubiquitin-conjugating enzyme E2 J2 (EC 6.3.2.19)| (Non-canonical ubiquitin-conjugating enzyme 2) (NCUBE2) Length = 259 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILK---DKWSPALQIRTVLLSIQALLSAPNP 9 E+P PP + +T + R+CL I D W+PA + T+L + + + P Sbjct: 70 EFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGP 127
>UB2J2_HUMAN (Q8N2K1) Ubiquitin-conjugating enzyme E2 J2 (EC 6.3.2.19)| (Non-canonical ubiquitin-conjugating enzyme 2) (NCUBE2) Length = 259 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICLDILK---DKWSPALQIRTVLLSIQALLSAPNP 9 E+P PP + +T + R+CL I D W+PA + T+L + + + P Sbjct: 70 EFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGP 127
>MMS2_SCHPO (O74983) Ubiquitin-conjugating enzyme spm2 (Ubiquitin-conjugating| enzyme variant MMS2 homolog) (UEV MMS2) Length = 139 Score = 29.6 bits (65), Expect = 2.3 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = -2 Query: 176 YPMAPPKVRFLTKIYHPNID----KLGRICLDILKDKWSPALQIRTVLLSIQ 33 YP APP V F+++I P +D K+ +D L+ W + TVLL ++ Sbjct: 68 YPDAPPIVTFVSRINLPGVDGETGKVNPHKIDCLR-HWKREYSMETVLLDLK 118
>UBC6_KLULA (Q6CMG6) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC6) (Ubiquitin carrier protein UBC6) Length = 251 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRICL---DILKDKWSPALQIRTVLLSIQALLS 21 +YP PP +R +T + + R+CL D + W+PA + T+L + + ++ Sbjct: 63 DYPFNPPAIRMITP--NGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMT 116
>UB2V1_MOUSE (Q9CZY3) Ubiquitin-conjugating enzyme E2 variant 1 (UEV-1) (CROC-1)| Length = 147 Score = 29.3 bits (64), Expect = 3.0 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -2 Query: 179 EYPMAPPKVRFLTKIYHPNIDKLGRIC---LDILKDKWSPALQIRTVLLSIQALL 24 +YP APP VRF+T++ + + + KW + I+ +L ++ L+ Sbjct: 74 KYPEAPPSVRFVTRVNMSGVSSSNGVVDPRATAVLAKWQNSHSIKVILQELRRLM 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,816,733 Number of Sequences: 219361 Number of extensions: 465883 Number of successful extensions: 1453 Number of sequences better than 10.0: 169 Number of HSP's better than 10.0 without gapping: 1381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1399 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
