Clone Name | rbasd13c05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TNR5_BOVIN (Q28203) Tumor necrosis factor receptor superfamily m... | 32 | 2.1 | 2 | OR3A1_GORGO (Q9TU89) Olfactory receptor 3A1 | 31 | 3.6 | 3 | SMG_DROME (Q23972) Protein Smaug | 30 | 4.8 |
---|
>TNR5_BOVIN (Q28203) Tumor necrosis factor receptor superfamily member 5| precursor (CD40L receptor) (B-cell surface antigen CD40) (Fragment) Length = 269 Score = 31.6 bits (70), Expect = 2.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 557 VHVEEIDVPGKYSYPISSYCCQLLPP 480 VH E G+ YP++S CC L PP Sbjct: 18 VHSEPATACGEKQYPVNSLCCDLCPP 43
>OR3A1_GORGO (Q9TU89) Olfactory receptor 3A1| Length = 315 Score = 30.8 bits (68), Expect = 3.6 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 7/59 (11%) Frame = -1 Query: 406 LCRLACNWTCLSEVICYKV-FVVHVGCFALEKAKNAYVLARVLE------KRKAFATAG 251 LC+L+C+ T LSE++ + V F++ AL +V A VL ++KAF+T G Sbjct: 187 LCQLSCSSTQLSELLLFAVGFIMAGTSMALIVISYIHVAAAVLRIRSVEGRKKAFSTCG 245
>SMG_DROME (Q23972) Protein Smaug| Length = 999 Score = 30.4 bits (67), Expect = 4.8 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = +1 Query: 178 HKTTTHPQNLNDASEKPCKIAM*HPPPLQK----PCVSQELLREHKHF*PFPEQS 330 +K++++P + + ++P PPP K P Q++L++H HF P+Q+ Sbjct: 858 YKSSSYPSFMGNPQQQP------PPPPSSKSHHHPQQMQQMLQQHNHFPALPQQT 906 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,759,992 Number of Sequences: 219361 Number of extensions: 1900475 Number of successful extensions: 4351 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4350 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)