Clone Name | rbasd13a12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GALT_CLOAB (Q97EZ4) Galactose-1-phosphate uridylyltransferase (E... | 30 | 2.4 | 2 | RPP8_ARATH (Q8W4J9) Disease resistance protein RPP8 (Resistance ... | 28 | 9.0 |
---|
>GALT_CLOAB (Q97EZ4) Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12)| (Gal-1-P uridylyltransferase) (UDP-glucose--hexose-1-phosphate uridylyltransferase) Length = 497 Score = 30.0 bits (66), Expect = 2.4 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 8/90 (8%) Frame = +3 Query: 111 ISRANIYSFLSYLLIYKLTK*DNFFGLFRHPTQ*SVRIL---FNKILW-----NHRFCRS 266 I++A + SY + + F+G HP + ++RI+ NK W + + Sbjct: 159 IAKAKLSKSTSYPKCLLCKENEGFYGNINHPARQTLRIIPLELNKSKWFLQYSPYTYYNE 218 Query: 267 HCFSLNG*V*IPQRSFQKISFRVNFLSFIN 356 HC LN IP + +I+F N LSFI+ Sbjct: 219 HCIILNN-EHIPMK-ISRITFE-NLLSFID 245
>RPP8_ARATH (Q8W4J9) Disease resistance protein RPP8 (Resistance to Peronospora| parasitica protein 8) Length = 908 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 283 FKEKQWERQNL*FHRILLKRILTLHWV 203 F+E W R FH + L R+L L WV Sbjct: 560 FEEDYWIRSASVFHNLTLLRVLDLSWV 586 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,897,403 Number of Sequences: 219361 Number of extensions: 910629 Number of successful extensions: 1574 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1574 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)