ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd11m22 |
|---|---|
| Clone Library Name | barley_pub |
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 75.1 bits (183), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 113 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEG 12 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEG Sbjct: 39 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEG 72
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 72.8 bits (177), Expect = 3e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 113 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE Sbjct: 39 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 71
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 72.8 bits (177), Expect = 3e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 113 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE Sbjct: 38 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 70
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 72.8 bits (177), Expect = 3e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 113 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE Sbjct: 38 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 70
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 113 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 VSNGGRIRCMQVWPIEGIKKFETLSYLPPL+ E Sbjct: 39 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLTVE 71
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 64.7 bits (156), Expect = 7e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 107 NGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 +GGRIRCMQVWPIEGIKKFETLSYLPPL+ E Sbjct: 39 HGGRIRCMQVWPIEGIKKFETLSYLPPLTVE 69
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 64.3 bits (155), Expect = 9e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 113 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 VSNGGRI+ MQVWPIEGIKKFETLSYLPPL+ E Sbjct: 39 VSNGGRIKFMQVWPIEGIKKFETLSYLPPLTVE 71
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 64.3 bits (155), Expect = 9e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 113 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 VSNGGRIRCMQVWP G KKFETLSYLPPLST+ Sbjct: 39 VSNGGRIRCMQVWPAYGNKKFETLSYLPPLSTD 71
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+ CMQVWP EG+KKFETLSYLPPLS E Sbjct: 50 SNGGRVSCMQVWPPEGLKKFETLSYLPPLSVE 81
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+ CMQVWP EG+KKFETLSYLPPLS E Sbjct: 50 SNGGRVSCMQVWPPEGLKKFETLSYLPPLSVE 81
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+ CMQVWP EG+KKFETLSYLPPLS E Sbjct: 50 SNGGRVSCMQVWPPEGLKKFETLSYLPPLSVE 81
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 62.8 bits (151), Expect = 3e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G+KKFETLSYLPPLSTE Sbjct: 53 SNGGRVQCMQVWPPLGLKKFETLSYLPPLSTE 84
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 62.0 bits (149), Expect = 4e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGG++ CMQVWP EG+KKFETLSYLPPLS E Sbjct: 50 SNGGKVSCMQVWPPEGLKKFETLSYLPPLSVE 81
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 113 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 VSNGGRIRCMQVWP G KKFETLSYLPPL+ E Sbjct: 38 VSNGGRIRCMQVWPAYGNKKFETLSYLPPLTQE 70
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 61.6 bits (148), Expect = 6e-10 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 107 NGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 NGGR+ CMQVWP EG+KKFETLSYLPPLS E Sbjct: 51 NGGRVSCMQVWPPEGLKKFETLSYLPPLSVE 81
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 61.2 bits (147), Expect = 8e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 S+GGR+ CMQVWP EG+KKFETLSYLPPLS E Sbjct: 46 SSGGRVSCMQVWPPEGLKKFETLSYLPPLSVE 77
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 61.2 bits (147), Expect = 8e-10 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G+KKFETLSYLPPLS+E Sbjct: 52 SNGGRVQCMQVWPPLGLKKFETLSYLPPLSSE 83
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 61.2 bits (147), Expect = 8e-10 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G+KKFETLSYLPPLS+E Sbjct: 53 SNGGRVQCMQVWPPLGLKKFETLSYLPPLSSE 84
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G+KKFETLSYLPPLS E Sbjct: 51 SNGGRVQCMQVWPPLGMKKFETLSYLPPLSEE 82
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CM+VWPIEG+KKFETLSYLP + E Sbjct: 51 SNGGRVQCMKVWPIEGVKKFETLSYLPTMKDE 82
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 59.3 bits (142), Expect = 3e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CM+VWPI G+KKFETLSYLP LS E Sbjct: 52 SNGGRVQCMKVWPIVGLKKFETLSYLPTLSVE 83
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 59.3 bits (142), Expect = 3e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CM+VWPI G+KKFETLSYLP LS E Sbjct: 52 SNGGRVQCMKVWPIVGLKKFETLSYLPTLSVE 83
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 59.3 bits (142), Expect = 3e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CM+VWPI G+KKFETLSYLP LS E Sbjct: 52 SNGGRVQCMKVWPIVGLKKFETLSYLPTLSVE 83
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 59.3 bits (142), Expect = 3e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CM+VWPI G+KKFETLSYLP LS E Sbjct: 52 SNGGRVQCMKVWPIVGLKKFETLSYLPTLSVE 83
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 58.5 bits (140), Expect = 5e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G KKFETLSYLPPLS E Sbjct: 51 SNGGRVQCMQVWPPLGKKKFETLSYLPPLSEE 82
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 58.5 bits (140), Expect = 5e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G KKFETLSYLPPLS E Sbjct: 48 SNGGRVQCMQVWPPLGKKKFETLSYLPPLSEE 79
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 58.2 bits (139), Expect = 6e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNG R+RCMQVWP EG KKFETLSYLPPL+ E Sbjct: 49 SNGLRVRCMQVWPPEGKKKFETLSYLPPLTRE 80
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 57.8 bits (138), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CM+VWP G+KK+ETLSYLPPLS E Sbjct: 50 SNGGRVQCMKVWPPIGLKKYETLSYLPPLSDE 81
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 57.4 bits (137), Expect = 1e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CM+VWP G++KFETLSYLPPLS E Sbjct: 52 SNGGRVQCMKVWPPLGLQKFETLSYLPPLSIE 83
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 +NGGR++CMQVWP G KKFETLSYLPPLS E Sbjct: 50 TNGGRVQCMQVWPPLGKKKFETLSYLPPLSEE 81
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CMQVWP G KKFETLSYLPPLS Sbjct: 52 SNGGRVQCMQVWPPVGKKKFETLSYLPPLS 81
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CMQVWP G KKFETLSYLPPLS Sbjct: 53 SNGGRVQCMQVWPPVGKKKFETLSYLPPLS 82
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGG+++CMQVWP G KKFETLSYLPPLS E Sbjct: 54 SNGGKVQCMQVWPPLGKKKFETLSYLPPLSEE 85
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+ CMQVWP G KKFETLSYLPPL+ E Sbjct: 50 SNGGRVNCMQVWPPVGKKKFETLSYLPPLTEE 81
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CMQVWP G KKFETLSYLPPLS Sbjct: 50 SNGGRVQCMQVWPPVGKKKFETLSYLPPLS 79
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGG+++CM+VWP G+KKFETLSYLPPL+ E Sbjct: 52 SNGGKVQCMKVWPTLGMKKFETLSYLPPLTRE 83
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G KKFETLSYLPPL+ + Sbjct: 50 SNGGRVKCMQVWPPIGKKKFETLSYLPPLTRD 81
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 56.6 bits (135), Expect = 2e-08 Identities = 21/32 (65%), Positives = 30/32 (93%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CM+VWP + +K++ETLSYLPPL+T+ Sbjct: 50 SNGGRVQCMKVWPTQNMKRYETLSYLPPLTTD 81
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G KKFETLSYLPPL+ + Sbjct: 50 SNGGRVKCMQVWPPIGKKKFETLSYLPPLTRD 81
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 55.8 bits (133), Expect = 3e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+RCMQVWP +KK+ETLSYLP LS+E Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSSE 81
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 55.1 bits (131), Expect = 5e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+RCMQVWP +KK+ETLSYLP LS E Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDE 82
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 55.1 bits (131), Expect = 5e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+RCMQVWP +KK+ETLSYLP LS E Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDE 82
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 55.1 bits (131), Expect = 5e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+RCMQVWP +KK+ETLSYLP LS E Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDE 82
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 55.1 bits (131), Expect = 5e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+RCMQVWP +KK+ETLSYLP LS E Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDE 81
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 55.1 bits (131), Expect = 5e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+RCMQVWP +KK+ETLSYLP LS E Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDE 81
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 55.1 bits (131), Expect = 5e-08 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+RCMQVWP +KK+ETLSYLP LS E Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDE 81
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 55.1 bits (131), Expect = 5e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNG R+ CMQVWP G KKFETLSYLPPL+ E Sbjct: 48 SNGSRVNCMQVWPPVGKKKFETLSYLPPLTDE 79
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 55.1 bits (131), Expect = 5e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CM+VWP G+KK+ETLSYLPPL+ Sbjct: 48 SNGGRVQCMKVWPPLGLKKYETLSYLPPLT 77
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 54.7 bits (130), Expect = 7e-08 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 +NGGR+ CMQVWP +KKFETLSYLP LS E Sbjct: 49 TNGGRVNCMQVWPPRNLKKFETLSYLPTLSEE 80
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 54.3 bits (129), Expect = 9e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G K +ETLSYLPPL+ E Sbjct: 52 SNGGRVQCMQVWPPRGKKFYETLSYLPPLTRE 83
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 53.9 bits (128), Expect = 1e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+RCMQVWP +KK+ETLSYLP L+ E Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLTDE 82
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 53.9 bits (128), Expect = 1e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPL 24 SNGGR++CMQVWP G KKFETLSYLP L Sbjct: 48 SNGGRVQCMQVWPTTGKKKFETLSYLPDL 76
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 53.9 bits (128), Expect = 1e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPL 24 SNGGR++CMQVWP G KKFETLSYLP L Sbjct: 48 SNGGRVQCMQVWPTTGKKKFETLSYLPDL 76
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 53.5 bits (127), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNG R++CMQVWP G KKFETLSYLPPL+ + Sbjct: 6 SNGERVKCMQVWPPIGKKKFETLSYLPPLTRD 37
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+RCMQVWP G KFETLSYLP L+ E Sbjct: 44 SNGGRVRCMQVWPPFGNPKFETLSYLPTLTEE 75
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 53.5 bits (127), Expect = 2e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CM VWP G+KKFETLSYLPPLS E Sbjct: 51 SNGGRVQCM-VWPPLGMKKFETLSYLPPLSEE 81
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 53.5 bits (127), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G KK+ETLSYLP L+ E Sbjct: 50 SNGGRVQCMQVWPPYGKKKYETLSYLPDLTDE 81
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 53.5 bits (127), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP G KK+ETLSYLP L+ E Sbjct: 50 SNGGRVQCMQVWPPYGKKKYETLSYLPDLTDE 81
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CMQVWP G KKFETLSYLP L+ Sbjct: 52 SNGGRVQCMQVWPPLGKKKFETLSYLPDLT 81
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+ CMQVWP +KK+ETLSYLP LS E Sbjct: 50 SNGGRVSCMQVWPPINMKKYETLSYLPDLSDE 81
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+ CMQVWP +KK+ETLSYLP LS E Sbjct: 50 SNGGRVSCMQVWPPINMKKYETLSYLPDLSDE 81
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+ CMQVWP +KK+ETLSYLP LS E Sbjct: 50 SNGGRVSCMQVWPPINMKKYETLSYLPDLSDE 81
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 52.8 bits (125), Expect = 3e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPL 24 SNGGR++CMQVWP G KKFETLSYLP L Sbjct: 48 SNGGRVQCMQVWPPVGKKKFETLSYLPDL 76
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 52.4 bits (124), Expect = 4e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 113 VSNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 VSNGGR+ CM+VWP G KKFETLSYLP L+ Sbjct: 47 VSNGGRVSCMKVWPPVGKKKFETLSYLPDLT 77
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 52.4 bits (124), Expect = 4e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR+ CMQVWP G KKFETLSYLP L+ Sbjct: 48 SNGGRVNCMQVWPPIGKKKFETLSYLPDLT 77
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 52.4 bits (124), Expect = 4e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPL 24 SNGGR++CMQVWP G KKFETLSYLP L Sbjct: 48 SNGGRVQCMQVWPPIGKKKFETLSYLPDL 76
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 52.0 bits (123), Expect = 5e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP KK+ETLSYLP LS E Sbjct: 51 SNGGRVQCMQVWPPINKKKYETLSYLPDLSEE 82
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 52.0 bits (123), Expect = 5e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP KK+ETLSYLP LS E Sbjct: 50 SNGGRVQCMQVWPPINKKKYETLSYLPDLSQE 81
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 52.0 bits (123), Expect = 5e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP KK+ETLSYLP LS E Sbjct: 50 SNGGRVQCMQVWPPINKKKYETLSYLPDLSQE 81
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 52.0 bits (123), Expect = 5e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR++CMQVWP KK+ETLSYLP LS E Sbjct: 50 SNGGRVQCMQVWPPINKKKYETLSYLPDLSQE 81
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 51.6 bits (122), Expect = 6e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR+ CM+VWP G KKFETLSYLP LS Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLS 77
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 51.6 bits (122), Expect = 6e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR+ CM+VWP G KKFETLSYLP LS Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLS 77
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 51.6 bits (122), Expect = 6e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR+ CM+VWP G KKFETLSYLP LS Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLS 77
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 51.2 bits (121), Expect = 8e-07 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNG R+RCMQVWP KKFETLSYLP L+ E Sbjct: 60 SNGSRVRCMQVWPPYANKKFETLSYLPRLTPE 91
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 50.8 bits (120), Expect = 1e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR+ CM+VWP G KKFETLSYLP L+ Sbjct: 48 SNGGRVSCMKVWPPVGKKKFETLSYLPDLT 77
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 50.8 bits (120), Expect = 1e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SN G+++CM+VWP G++KFETLSYLP +S E Sbjct: 52 SNAGKVQCMKVWPPLGLRKFETLSYLPDMSNE 83
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CM+VWP G KK+ETLSYLP L+ Sbjct: 43 SNGGRVQCMKVWPPVGKKKYETLSYLPELT 72
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR+ CM+VWP G KKFETLSYLP L+ Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLT 77
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 50.1 bits (118), Expect = 2e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CM+VWP G KK+ETLSYLP L+ Sbjct: 43 SNGGRVQCMKVWPPLGKKKYETLSYLPDLT 72
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CM+VWP G KK+ETLSYLP L+ Sbjct: 48 SNGGRVQCMKVWPPLGKKKYETLSYLPNLT 77
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 48.9 bits (115), Expect = 4e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 SNGGR+ CM VWP KK+ETLSYLP LS E Sbjct: 50 SNGGRVECMLVWPPINKKKYETLSYLPDLSDE 81
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 48.5 bits (114), Expect = 5e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CM+VWP G K++ETLSYLP L+ Sbjct: 43 SNGGRVQCMKVWPPLGKKRYETLSYLPNLT 72
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 48.5 bits (114), Expect = 5e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CM+VWP G K++ETLSYLP L+ Sbjct: 43 SNGGRVQCMKVWPPLGKKRYETLSYLPNLT 72
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 48.5 bits (114), Expect = 5e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CM+VWP G K++ETLSYLP L+ Sbjct: 43 SNGGRVQCMKVWPPLGKKRYETLSYLPNLT 72
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 48.5 bits (114), Expect = 5e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CM+VWP G K++ETLSYLP L+ Sbjct: 48 SNGGRVQCMKVWPPLGKKRYETLSYLPNLT 77
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 47.4 bits (111), Expect = 1e-05 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLS 21 SNGGR++CM+VWP G KK+ TLSYLP L+ Sbjct: 43 SNGGRVQCMKVWPPLGKKKYXTLSYLPNLT 72
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 46.2 bits (108), Expect = 3e-05 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLSTE 15 MQVWP G+KKFETLSYLPPL+TE Sbjct: 1 MQVWPPLGLKKFETLSYLPPLTTE 24
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 45.4 bits (106), Expect = 4e-05 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -1 Query: 110 SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 +NG R+ CMQVW KFETLSYLPPLS + Sbjct: 51 TNGSRVSCMQVWEPYNNLKFETLSYLPPLSQD 82
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 33.1 bits (74), Expect = 0.22 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLS 21 M+VW KKFET SYLPPLS Sbjct: 1141 MKVWNPVNNKKFETFSYLPPLS 1162 Score = 33.1 bits (74), Expect = 0.22 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLS 21 M+VW KKFET SYLPPLS Sbjct: 997 MKVWNPVNNKKFETFSYLPPLS 1018 Score = 33.1 bits (74), Expect = 0.22 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLS 21 M+VW KKFET SYLPPLS Sbjct: 854 MKVWNPVNNKKFETFSYLPPLS 875 Score = 33.1 bits (74), Expect = 0.22 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLS 21 M+VW KKFET SYLPPLS Sbjct: 709 MKVWNPVNNKKFETFSYLPPLS 730 Score = 33.1 bits (74), Expect = 0.22 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLS 21 M+VW KKFET SYLPPLS Sbjct: 566 MKVWNPVNNKKFETFSYLPPLS 587 Score = 33.1 bits (74), Expect = 0.22 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLS 21 M+VW KKFET SYLPPLS Sbjct: 422 MKVWNPVNNKKFETFSYLPPLS 443 Score = 33.1 bits (74), Expect = 0.22 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLS 21 M+VW KKFET SYLPPLS Sbjct: 279 MKVWNPVNNKKFETFSYLPPLS 300 Score = 33.1 bits (74), Expect = 0.22 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLS 21 M+VW KKFET SYLPPLS Sbjct: 135 MKVWNPVNNKKFETFSYLPPLS 156
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 32.3 bits (72), Expect = 0.38 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -1 Query: 113 VSNG--GRIRCMQVWPIEGIKKFETLSYLPPLSTE 15 +SNG + R M VW K FET SYLPPL+ + Sbjct: 25 LSNGTISKSRAMMVWEPFNNKFFETFSYLPPLTDD 59
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 32.3 bits (72), Expect = 0.38 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLSTE 15 M VW K FET SYLPPLS E Sbjct: 46 MMVWTPVNNKMFETFSYLPPLSDE 69
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 32.0 bits (71), Expect = 0.50 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -1 Query: 98 RIRCMQVWPIEGIKKFETLSYLPPLSTE 15 + R M VW K FET SYLPPL+ E Sbjct: 40 KCRDMMVWQPFNNKMFETFSYLPPLTDE 67
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 31.6 bits (70), Expect = 0.65 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 92 RCMQVWPIEGIKKFETLSYLPPLSTE 15 R M VW K FET SYLPPL+ E Sbjct: 42 RDMMVWQPFNNKMFETFSYLPPLTDE 67
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 31.2 bits (69), Expect = 0.85 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 86 MQVWPIEGIKKFETLSYLPPLSTE 15 M VW K FET SYLPPL+ E Sbjct: 46 MMVWTPVNNKMFETFSYLPPLTDE 69
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 31.2 bits (69), Expect = 0.85 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 92 RCMQVWPIEGIKKFETLSYLPPLSTE 15 R M VW K FET SYLPPL+ E Sbjct: 43 REMMVWQPFNNKMFETFSYLPPLTDE 68
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 31.2 bits (69), Expect = 0.85 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 92 RCMQVWPIEGIKKFETLSYLPPLSTE 15 R M VW K FET SYLPPL+ E Sbjct: 41 REMMVWQPFNNKMFETFSYLPPLTDE 66
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 31.2 bits (69), Expect = 0.85 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 92 RCMQVWPIEGIKKFETLSYLPPLSTE 15 R M VW K FET SYLPPL+ E Sbjct: 41 REMMVWQPFNNKMFETFSYLPPLTDE 66
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 30.0 bits (66), Expect = 1.9 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 92 RCMQVWPIEGIKKFETLSYLPPLSTE 15 R M VW K FET S+LPPL+ E Sbjct: 42 RDMMVWQPFNNKMFETFSFLPPLTDE 67
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 30.0 bits (66), Expect = 1.9 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 92 RCMQVWPIEGIKKFETLSYLPPLSTE 15 R M VW K FET S+LPPL+ E Sbjct: 41 RGMMVWQPFNNKMFETFSFLPPLTDE 66
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 29.6 bits (65), Expect = 2.5 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 92 RCMQVWPIEGIKKFETLSYLPPLSTE 15 R M VW K FET S+LPPL+ E Sbjct: 32 REMMVWQPFNNKMFETFSFLPPLTDE 57
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 29.6 bits (65), Expect = 2.5 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 92 RCMQVWPIEGIKKFETLSYLPPLSTE 15 R M VW K FET S+LPPL+ E Sbjct: 41 REMMVWQPFNNKMFETFSFLPPLTDE 66
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 29.6 bits (65), Expect = 2.5 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 92 RCMQVWPIEGIKKFETLSYLPPLSTE 15 R M VW K FET S+LPPL+ E Sbjct: 41 REMMVWQPFNNKMFETFSFLPPLTDE 66
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 28.5 bits (62), Expect = 5.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 83 QVWPIEGIKKFETLSYLPPLSTE 15 +VW K++ET SYLPPL+ + Sbjct: 30 KVWQPVNNKQYETFSYLPPLTNQ 52
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 28.5 bits (62), Expect = 5.5 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -1 Query: 59 KKFETLSYLPPLSTE 15 K++ETLSYLPPLS + Sbjct: 8 KRYETLSYLPPLSDQ 22
>KNAP3_MALDO (O04136) Homeobox protein knotted-1-like 3 (KNAP3)| Length = 427 Score = 27.7 bits (60), Expect = 9.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 105 RWKDQVHAGVAHRGHQEVRDPVLLA 31 +W Q H + HR H +V D V +A Sbjct: 101 QWLSQSHRPILHRNHSDVNDDVTVA 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,254,391 Number of Sequences: 219361 Number of extensions: 252096 Number of successful extensions: 1056 Number of sequences better than 10.0: 105 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 80,573,946 effective HSP length: 13 effective length of database: 77,722,253 effective search space used: 1865334072 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
