Clone Name | rbasd11l21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NQRA_CHLTR (O84639) Probable Na(+)-translocating NADH-quinone re... | 30 | 2.1 | 2 | NQRA_CHLMU (Q9PLU3) Probable Na(+)-translocating NADH-quinone re... | 29 | 2.7 | 3 | TAF5_SCHPO (O13282) Transcription initiation factor TFIID subuni... | 29 | 3.6 |
---|
>NQRA_CHLTR (O84639) Probable Na(+)-translocating NADH-quinone reductase| subunit A (EC 1.6.5.-) (Na(+)-translocating NQR subunit A) (Na(+)-NQR subunit A) (NQR complex subunit A) (NQR-1 subunit A) Length = 465 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 6 TRTHFYFLKIGWSKVHVQYTYL 71 TR F FL++GW+K+ V TYL Sbjct: 343 TRESFSFLRLGWNKLTVTRTYL 364
>NQRA_CHLMU (Q9PLU3) Probable Na(+)-translocating NADH-quinone reductase| subunit A (EC 1.6.5.-) (Na(+)-translocating NQR subunit A) (Na(+)-NQR subunit A) (NQR complex subunit A) (NQR-1 subunit A) Length = 465 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 6 TRTHFYFLKIGWSKVHVQYTYL 71 TR F FL++GW+K+ V TYL Sbjct: 343 TREMFSFLRLGWNKLTVTRTYL 364
>TAF5_SCHPO (O13282) Transcription initiation factor TFIID subunit 5| (Transcription initiation factor TFIID 72 kDa subunit) (TAFII-72) Length = 643 Score = 28.9 bits (63), Expect = 3.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 5 YTHTFLFLENWLVQSPCPIYVPTYIMLCFPFEVHS 109 YTHT+ L +W V S +Y + FP VHS Sbjct: 57 YTHTYTILRDW-VDSSLELYKAELHRILFPIFVHS 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,454,377 Number of Sequences: 219361 Number of extensions: 634703 Number of successful extensions: 1389 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1389 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)