Clone Name | rbasd11l17 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FUCO2_PONPY (Q5RFI5) Plasma alpha-L-fucosidase precursor (EC 3.2... | 33 | 0.98 | 2 | FUCO2_HUMAN (Q9BTY2) Plasma alpha-L-fucosidase precursor (EC 3.2... | 33 | 0.98 | 3 | XYNC_PSEFL (P23031) Alpha-L-arabinofuranosidase C precursor (EC ... | 30 | 8.3 |
---|
>FUCO2_PONPY (Q5RFI5) Plasma alpha-L-fucosidase precursor (EC 3.2.1.51)| (Alpha-L-fucosidase 2) (Alpha-L-fucoside fucohydrolase 2) Length = 465 Score = 32.7 bits (73), Expect = 0.98 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +2 Query: 374 WQNVTARQL---YSAIHLGDETFIFLSWSVVQYP--GLVWFWFCLERHAFPNYRE 523 W+++ ARQL + G IF+ W V P G WFW+ ++ P Y E Sbjct: 36 WESLDARQLPAWFDQAKFG----IFIHWGVFSVPSFGSEWFWWYWQKEKIPKYVE 86
>FUCO2_HUMAN (Q9BTY2) Plasma alpha-L-fucosidase precursor (EC 3.2.1.51)| (Alpha-L-fucosidase 2) (Alpha-L-fucoside fucohydrolase 2) Length = 467 Score = 32.7 bits (73), Expect = 0.98 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +2 Query: 374 WQNVTARQL---YSAIHLGDETFIFLSWSVVQYP--GLVWFWFCLERHAFPNYRE 523 W+++ ARQL + G IF+ W V P G WFW+ ++ P Y E Sbjct: 38 WESLDARQLPAWFDQAKFG----IFIHWGVFSVPSFGSEWFWWYWQKEKIPKYVE 88
>XYNC_PSEFL (P23031) Alpha-L-arabinofuranosidase C precursor (EC 3.2.1.55)| (Xylanase C) Length = 571 Score = 29.6 bits (65), Expect = 8.3 Identities = 15/62 (24%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +2 Query: 287 WIIKT*RHIYRTINRNEQIDYLYKSNLTNWQNVTARQLYSAIHLGD-ETFIFLSWSVVQY 463 W+I H Y +R++ + Y+ K+ L N+ N + + H G+ +++F + +V + Sbjct: 451 WVICNDTHCYLYFSRDDGVLYVSKTTLANFPNFSGYSIVMEDHRGNGNSYLFEAANVYKL 510 Query: 464 PG 469 G Sbjct: 511 DG 512 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,723,620 Number of Sequences: 219361 Number of extensions: 1858670 Number of successful extensions: 3507 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3505 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)