Clone Name | rbasd11l04 |
---|---|
Clone Library Name | barley_pub |
>STAT1_PIG (Q764M5) Signal transducer and activator of transcription 1| Length = 757 Score = 31.6 bits (70), Expect = 2.5 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 430 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 537 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>STAT1_HUMAN (P42224) Signal transducer and activator of transcription| 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) Length = 750 Score = 31.6 bits (70), Expect = 2.5 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 430 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 537 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>PLMN_HUMAN (P00747) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.4 bits (67), Expect = 5.5 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -1 Query: 193 GEVVTRFP*VNLRKDHCRDPDQN-RP-CSRHPILRRW 89 G + ++FP NL+K++CR+PD+ RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRW 254
>PLMN_MACMU (P12545) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.0 bits (66), Expect = 7.2 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -1 Query: 193 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPILRRW 89 G + ++FP NL+K++CR+PD + RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDGEPRPWCFTTDPNKRW 254
>TRPG_CAEEL (Q93971) Transient receptor potential channel (Abnormal gonad| development protein 2) Length = 2032 Score = 30.0 bits (66), Expect = 7.2 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +3 Query: 243 RTAPVAAIRTLHRTIQSVGATGGVYKGQGRSQRELMTRA 359 RTAP+ R HR +S TGGVY +G R L+ A Sbjct: 124 RTAPIKKTRK-HRRRRSGSFTGGVYPRKGHRNRSLLGHA 161
>GATA6_ARATH (Q6DBP8) GATA transcription factor 6 (AtGATA-6)| Length = 303 Score = 29.6 bits (65), Expect = 9.4 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -2 Query: 132 TKTDRARVIQSSDDGIVRRSANSSTASTP--RSGGSGKRT 19 T+T + + S+ DGIVR+ + T TP R G SG +T Sbjct: 203 TRTVSSTLEASNSDGIVRKCTHCETTKTPQWREGPSGPKT 242
>BCL9_DROME (Q961D9) Bcl-9 homolog (Protein legless)| Length = 1469 Score = 29.6 bits (65), Expect = 9.4 Identities = 29/103 (28%), Positives = 43/103 (41%) Frame = +2 Query: 248 RPRRRDPNTSPDHSIGRSDGRCVQRAGT*STRADDSRLLGIPR*RPTIAMIYPHHDEISQ 427 RP + P P HSI RS + T S L +P R T A++ + S Sbjct: 758 RPLQGPP--PPYHSIQRSASVPI---ATQSPNPSSPNNLSLPSPRTTAAVMGLPTNSPSM 812 Query: 428 DYPGLSAKAIYSLNTSV*RACGPEHLRASQTCYCLKLPSPKRR 556 D G + ++ NTS +A L A++ C+ PSP + Sbjct: 813 DGTGSLSGSVPQANTSTVQAGTTTVLSANKNCFQADTPSPSNQ 855 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,553,464 Number of Sequences: 219361 Number of extensions: 1990147 Number of successful extensions: 4239 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4238 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)