Clone Name | rbasd11h13 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TILS_GEOKA (Q5L3T3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tR... | 30 | 4.6 |
---|
>TILS_GEOKA (Q5L3T3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 464 Score = 30.0 bits (66), Expect = 4.6 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 222 SRMVIEAECRYTDILTIEAQSSHSNQRTIFMRERYVHHQLKMLQGEN 362 SR IEA CR + + + SN++ + R R+ HH + +L+ EN Sbjct: 171 SRAEIEAYCRQ---MGLSPRCDPSNEKDDYTRNRFRHHIVPLLRQEN 214 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,853,553 Number of Sequences: 219361 Number of extensions: 1437202 Number of successful extensions: 2990 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2989 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)