Clone Name | rbasd11f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | APBE_TREPA (O83774) Thiamine biosynthesis lipoprotein apbE precu... | 30 | 6.7 | 2 | AIRE_HUMAN (O43918) Autoimmune regulator (Autoimmune polyendocri... | 30 | 8.8 |
---|
>APBE_TREPA (O83774) Thiamine biosynthesis lipoprotein apbE precursor| Length = 362 Score = 30.0 bits (66), Expect = 6.7 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 215 WNCGV*VCALPGLSSCGGSLRKAE 286 W GV VC L G+ SCGG R E Sbjct: 8 WRIGVLVCILCGVGSCGGRARVRE 31
>AIRE_HUMAN (O43918) Autoimmune regulator (Autoimmune polyendocrinopathy| candidiasis ectodermal dystrophy protein) (APECED protein) Length = 545 Score = 29.6 bits (65), Expect = 8.8 Identities = 24/60 (40%), Positives = 26/60 (43%), Gaps = 14/60 (23%) Frame = +2 Query: 365 LPSGLFSIGR-----PGEPKGEVAWSPAVLVRRRLPALPP---------EGLHLLLCQGP 502 LP GL S G PGEP +A LV + LPA P LH LLC GP Sbjct: 366 LPPGLRSAGEEVRGPPGEP---LAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGP 422 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,038,905 Number of Sequences: 219361 Number of extensions: 1652833 Number of successful extensions: 4256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4256 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)