Clone Name | rbasd11e18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FINC_HUMAN (P02751) Fibronectin precursor (FN) (Cold-insoluble g... | 29 | 3.7 | 2 | FINC_CHICK (P11722) Fibronectin (FN) (Fragments) | 28 | 4.8 |
---|
>FINC_HUMAN (P02751) Fibronectin precursor (FN) (Cold-insoluble globulin) (CIG)| Length = 2386 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = +3 Query: 27 MNADSVTRHQLAPSHSSTGYKIK---AY*NGKPKWDLNLHSMDKLVHSDI 167 + A+S T H +AP + TGY+I+ + +G+P+ D HS + + +++ Sbjct: 1369 ITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNL 1418
>FINC_CHICK (P11722) Fibronectin (FN) (Fragments)| Length = 1256 Score = 28.5 bits (62), Expect = 4.8 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +3 Query: 12 LXHGSMNADSVTRHQLAPSHSSTGYKIKAY*N---GKPKWD 125 L + A+S T H +AP + TGYKI+ + G+PK D Sbjct: 333 LDFSDITANSFTVHWIAPRATITGYKIRHHPEHGVGRPKED 373 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,264,111 Number of Sequences: 219361 Number of extensions: 588667 Number of successful extensions: 1290 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1290 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)