Clone Name | rbasd11e06 |
---|---|
Clone Library Name | barley_pub |
>IAAS_HORVU (P07596) Alpha-amylase/subtilisin inhibitor precursor (BASI)| Length = 203 Score = 32.3 bits (72), Expect = 1.4 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -2 Query: 456 WFLCLGGRSHGGYLVLAPGSPPLCAGVLLCLHLSSDPTTWHNVLPARI 313 +++ R+HGG L +APG C L +S DP H+ P RI Sbjct: 42 YYVLSANRAHGGGLTMAPGHGRHCP-----LFVSQDPNGQHDGFPVRI 84
>RP1_CANFA (Q8MJ04) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1 protein| homolog) Length = 2141 Score = 31.2 bits (69), Expect = 3.1 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = +1 Query: 256 NTNPHTAVQALAFRRSSMTDSRR*NVVPCSRIRGEVQTKEHTSTQGG 396 NTNPH+A+Q+ R+S+ + +VV C+ G TK HTS+ G Sbjct: 921 NTNPHSALQS---RKSAPIYKKDRSVVSCNN-NGFAGTKSHTSSGEG 963
>DHYS_METKA (Q8TXD7) Probable deoxyhypusine synthase (EC 2.5.1.46) (DHS)| Length = 297 Score = 30.4 bits (67), Expect = 5.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 185 ADEAPMIEVPGVLDQIVGGFIWVLIQTH 268 ADE I PG+LD +VG +W+ Q H Sbjct: 162 ADEGVPIYSPGILDSMVGLHVWIHSQDH 189
>NUKM_TRYBB (Q26783) NADH-ubiquinone oxidoreductase 20 kDa subunit,| mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-20KD) (CI-20KD) Length = 202 Score = 30.0 bits (66), Expect = 6.8 Identities = 16/62 (25%), Positives = 24/62 (38%), Gaps = 18/62 (29%) Frame = -2 Query: 459 RWFLCLGGRSHGG------YLVLA------------PGSPPLCAGVLLCLHLSSDPTTWH 334 +W + +G ++GG Y VL PG PP ++ CLH WH Sbjct: 134 KWVISMGSCANGGGYYHFSYAVLRGCERAIPVDFWIPGCPPSAESLVFCLHTLQKKIRWH 193 Query: 333 NV 328 + Sbjct: 194 EI 195
>SHAN3_HUMAN (Q9BYB0) SH3 and multiple ankyrin repeat domains protein 3 (Shank3)| (Proline-rich synapse-associated protein 2) (ProSAP2) (Fragment) Length = 797 Score = 29.6 bits (65), Expect = 8.9 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = +3 Query: 345 SDQRRGADKGAHQHTRGENPGLKQDNP-----RAISPRDTKTIFITVVACHASAP 494 S RG G + G+ PGL P R + R T+F++V A SAP Sbjct: 52 SPTHRGPRPGGLDYGAGDGPGLAFGGPGPAKDRRLEERRRSTVFLSVGAIEGSAP 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,169,708 Number of Sequences: 219361 Number of extensions: 2188242 Number of successful extensions: 4763 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4759 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)